(data stored in ACNUC7421 zone)

EMBL: CP001958.PE433

CP001958.PE433       Location/Qualifiers
FT   CDS_pept        421938..423272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0439"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: ami:Amir_0529 deoxyribodipyrimidine photo-
FT                   lyase; PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96926"
FT                   /db_xref="GOA:D6ZBU9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU9"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADG96926.1"
FT                   /translation="MSRPDLCWFRRDLRLADQPMLLEVAKEAVGLFVLDPRLTRGSGQA
FT                   RLDYLFSALAALDETLGGRLVVAEGDPARVVPDVARELNVGAVRCTEDFAPYGRARDAA
FT                   VAAALKAQGRELRPAGSPYAISPGRVRNGSGNPYRVFTPFRRAWSAHGWPRPAQTGADS
FT                   TRWLAAEVSCQTELPSPRLVREAGEQAAAARWTAFLEGALAGYAQNRDFPAVDGTSRLS
FT                   AHLKFGALHPRTLLRDIAAADADDTDKDVFVTELAWRDFYADVLSHHPRTAWHNVDRRF
FT                   DRFAWSDSQEHFAAWQRGETGYPIVDAGMRQLAAEGWMHNRVRMITASFLTKDLHLPWQ
FT                   WGARHFIRLLVDGDLASNSHGWQWTAGTGTDAAPYFRVFNPTAQGKKFDPGGEYIQRWV
FT                   PQLRDMPGPKAHEPNPRPAGYPPPIVDHAQERAEALLRYEAVKGR"
     atgagccgac ccgacctctg ctggttccgc cgcgatctgc gcctcgccga ccagccgatg        60
     ctgctggaag tcgccaaaga ggcggtgggg ctgttcgtcc tcgacccccg tttgacgcga       120
     ggcagcggac aagcccggct cgactacctg ttcagcgccc tcgccgcgtt ggacgaaacg       180
     ctcggcggca ggctggtcgt cgccgagggg gatcctgcgc gcgtcgtgcc ggacgtcgcg       240
     cgcgagctca acgtcggagc tgttcgctgc accgaggact tcgcgccgta cggccgcgcg       300
     cgggacgcgg cggtggccgc tgcgctcaag gcgcaaggcc gcgagctgcg cccggcgggc       360
     tcaccgtacg cgatcagccc tggccgggtc cgcaacggct ccggcaaccc ctatcgggtg       420
     ttcaccccgt tccggcgggc ttggtccgcg catggttggc ctcggcccgc ccaaacgggc       480
     gccgactcca cgcgctggct cgccgccgag gtctcgtgcc agacggagct tccctcgccc       540
     cggttggtcc gcgaggcggg tgagcaggcg gcggcggcac gctggacggc gttcctcgaa       600
     ggagccctgg cagggtacgc gcagaaccgg gacttccccg ccgtggacgg cacgagcagg       660
     ctgtccgccc acctgaaatt cggcgccctg cacccccgca cgcttttgcg ggatatcgca       720
     gccgcggacg cggacgacac ggacaaagac gtgttcgtca ccgagctcgc gtggcgcgac       780
     ttctacgccg atgtgctctc gcatcatccg cgcaccgcct ggcacaatgt ggaccggcgc       840
     ttcgacaggt tcgcgtggag cgattcgcaa gagcatttcg ccgcctggca acgcggcgag       900
     accgggtacc cgatcgtgga cgcggggatg cggcagttgg ccgccgaggg ctggatgcac       960
     aaccgggtgc ggatgatcac cgcctcattc ctcaccaaag acctgcatct gccctggcaa      1020
     tggggcgcgc gccatttcat acggcttctt gtggacgggg acctcgcctc caacagccac      1080
     ggctggcagt ggacggcggg caccggcacg gacgccgccc cgtatttccg ggtgttcaac      1140
     ccgactgcgc aaggcaagaa gttcgacccc ggcggggaat acatccaacg ctgggttccg      1200
     cagttgcgcg acatgccggg gcccaaggcc cacgagccga acccgaggcc ggcgggctac      1260
     ccgccgccca tcgtggacca cgcgcaggag cgcgccgaag cgttgctgcg ctatgaggcc      1320
     gtcaaaggac gctga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page