(data stored in ACNUC7421 zone)

EMBL: CP001958.PE435

CP001958.PE435       Location/Qualifiers
FT   CDS_pept        complement(423788..424735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0441"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein; SMART: HhH-GPD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96928"
FT                   /db_xref="GOA:D6ZBV1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV1"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADG96928.1"
FT                   /translation="MISSAAHPSGFEFSDGGRWPQAAQALIRWFGEHARALPWREPGVT
FT                   PWGVLLSEIMLQQTQVDRVRPIWEEWVCRWPSPAALAAQPLAEALRAWGRLGYPRRAAR
FT                   LHEASRVIVAEHDGEVPDELDALLALPGVGAYTARAVLAFAFGQRAPVVDVNVRRVLCR
FT                   VRRGEADGPARAQDLPDTLALLPQDPAAASALSAALMELGQTVCLPHAPNCAACPVHPC
FT                   RWARAGKPAAPEPAARRAPRYAGSDRQARGALLAALRASAEPLRKAELDQAWLANPVQR
FT                   ERALRSLVEDGLVHVADGGRVALGAADGRANAAE"
     atgatttcca gcgcggcaca cccaagcgga ttcgaattct ccgacggggg ccggtggccg        60
     caggcggcgc aggcgctgat ccgatggttc ggagagcacg cgagagcact gccctggcgg       120
     gaaccgggag tcaccccgtg gggtgtgttg ctcagcgaaa tcatgctgca acagacccag       180
     gtggaccggg tgcgcccgat ctgggaggag tgggtctgcc gatggccctc tcctgcggcg       240
     ctcgcagccc agccgctcgc cgaagcgctc cgggcatggg gcaggctcgg ctacccgagg       300
     cgggcggcgc ggctgcatga agcctcccgc gtgatcgtgg ctgagcacga cggcgaggtg       360
     cccgatgagc tcgacgcgct cctcgcgctg cccggagtcg gggcctacac ggcacgagcg       420
     gtgctcgcgt tcgcgttcgg acaacgcgcg ccggtcgtcg atgtgaacgt tcgtcgggtg       480
     ctgtgccgtg tccgccgcgg cgaggccgac ggccccgcgc gggcacaaga cctgccggac       540
     acgctcgccc tgctgccgca ggacccggcg gcggcgagcg cgctgtccgc cgcgctcatg       600
     gagctcggcc aaaccgtgtg cctgccgcac gccccgaact gcgccgcctg tcctgtccac       660
     ccgtgccgat gggcgcgcgc gggcaagccc gcagcgccgg agcccgccgc gcggcgcgcg       720
     cccaggtacg cgggcagcga ccggcaagcg agaggcgccc tgctcgccgc gctgcgcgcc       780
     agcgccgagc cgctgcgcaa agcggagctg gatcaggcgt ggctggcgaa cccggtccag       840
     cgcgagcggg cgctccgctc gctggtggag gacgggctcg tccacgtcgc cgacgggggc       900
     cgcgtcgcgc tcggcgcggc agacggacga gccaacgcag cagagtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page