(data stored in ACNUC7421 zone)

EMBL: CP001958.PE439

CP001958.PE439       Location/Qualifiers
FT   CDS_pept        427769..428257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0445"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: mmi:MMAR_5083
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96932"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV5"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADG96932.1"
FT                   /translation="MNFKIGDTVVYPHHGAALVEAIEVRTIKGVEKEYLVLKVGHGDLT
FT                   VRVPAENAEYIGIRDVVSDEGLDKVFNVLRDVHTEEPTNWSRRYKANIEKLASGDVHKV
FT                   AEVVRDLWRREQGRGLSAGEKRLLAKARQVLVGELALAESSDDAKAEGLLDEVLAQAS"
     atgaacttca aaattgggga caccgtcgtc tatccgcacc acggagccgc gcttgtcgag        60
     gctatcgagg tcagaaccat caaaggggtg gaaaaggagt acttggtgct caaagtcggc       120
     catggggacc tgaccgtccg cgtgcccgct gagaacgccg agtacatcgg catccgcgac       180
     gtggtgagcg acgagggcct cgacaaggtc ttcaacgttc tgcgcgatgt ccacaccgaa       240
     gagccgacca actggtcccg ccgatacaag gccaacatcg aaaagctcgc ttccggcgac       300
     gtgcacaagg tcgccgaggt cgtccgcgac ctgtggcgca gggaacaggg ccggggcctg       360
     tccgcgggcg agaagcgcct gctcgccaag gcccggcagg tgttggtcgg agaattggcg       420
     ctggcggaga gctcggacga cgcgaaagct gagggcctgc tcgacgaggt gctcgcccag       480
     gcctcgtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page