(data stored in ACNUC7421 zone)

EMBL: CP001958.PE44

CP001958.PE44        Location/Qualifiers
FT   CDS_pept        34539..34751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bln:Blon_1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96537"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96537.1"
FT                   /translation="MSARKLMAGAVAVVVVIAAAGCGASNEQINPPEPQVWRLPIADGR
FT                   KVVCVSISNSSNTAMSLSCDWGNAK"
     atgagcgccc gcaaactaat ggcaggagcc gtggccgtcg tcgtggtcat agccgccgct        60
     ggctgcggcg cttctaacga gcaaatcaac ccgcctgaac cgcaggtgtg gcggctgccc       120
     atagctgatg gccggaaagt cgtgtgtgtc tcgatcagca attcgagcaa cacggcgatg       180
     tccctttcct gtgattgggg gaatgcgaaa tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page