(data stored in ACNUC7421 zone)

EMBL: CP001958.PE440

CP001958.PE440       Location/Qualifiers
FT   CDS_pept        428274..429482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0446"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: nml:Namu_0867 2-C-methyl-D-erythritol 4-
FT                   phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   2C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase; 4-diphosphocytidyl-2C-methyl-
FT                   D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96933"
FT                   /db_xref="GOA:D6ZBV6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADG96933.1"
FT                   /translation="MGKVAAIIVASGSGSRLGAVDEAGEPCPKAFVFVGGHSMLARSVS
FT                   AAWRSGIVDEVVAVVPADRTAQARSAVDPRTRLVSGGATRTESVRAGLSQIAAADVVLV
FT                   HDAARALAPAQLFRSVAEAVVAGHAAVVPAVGVADTVKEVGPDGSVVRTLDRSCLRGAQ
FT                   TPQGFAADVLRQAHRGAVARDGASELDDAGLAELAGARVTAVEGDPLAFKITTPEDLVL
FT                   AEALARTTRGGAVETLLPRVGSGVDVHPIELGRPCWVAGLLFPESDGCAGHSDGDVAAH
FT                   ALVDAVLSAAGLGDLGTVFGVDRPQMRGASGELLLTEARKLVEQAGFVIGNAVVQVVGN
FT                   TPRLGPRRVEAQELLSAILGAPVSVAATTTDGLGLTGRGEGRAAVANALVYPASPRNAK
FT                   IAG"
     gtgggaaaag tggccgcgat cattgtggcc tctgggtctg gctcccggct cggcgctgtc        60
     gacgaggcag gcgagccctg cccgaaagct ttcgtcttcg tcggcggaca cagcatgctt       120
     gcacggtcgg tttccgccgc gtggcgctcc gggatcgtcg acgaggtcgt cgccgtggtc       180
     cccgccgacc ggaccgcgca ggccaggagc gccgtggacc caaggacgcg gctggtctcg       240
     ggcggagcca cccgcaccga gtccgtgcgg gcaggactca gccagatcgc agcggcagac       300
     gtggtgctcg tgcacgacgc ggctcgggcg ctcgcccctg cgcagctgtt ccgatccgtc       360
     gccgaagccg tcgtggcggg acacgccgcc gtggtccccg ccgtgggcgt ggccgacacg       420
     gtgaaagaag tgggcccgga cggctcggtc gtccgcacgt tggaccgctc gtgtctgcgc       480
     ggggcgcaaa caccccaagg gttcgcggcg gatgtgctcc gccaagcgca tcggggggcc       540
     gtcgcgcgag acggagcctc ggagctggac gacgcgggct tggcggaact cgccggggcg       600
     cgagtgacgg cggtcgaggg cgacccgctg gcgttcaaga tcaccacgcc cgaagacctc       660
     gtgctcgcgg aggcgttggc gcgcacaacg cgcggaggcg ccgtggagac gctgctgccc       720
     agggtcggca gcggggtcga cgtgcatccc atcgagctcg gccggccttg ctgggtggcg       780
     ggcctgttgt tccccgaatc cgacggctgc gccggtcact ccgacggtga cgtggccgcc       840
     catgcgctgg tcgacgcggt gctctcggcg gcaggcctgg gcgatttggg cacagttttc       900
     ggggtggacc ggccgcagat gcgcggcgct tccggcgagc tgctgctgac tgaggcgcgc       960
     aaactggtcg aacaggccgg gttcgtgatc ggcaacgctg tcgtccaagt cgtcgggaac      1020
     acccccaggc tcggcccccg ccgggtcgag gcgcaagagc tgctcagcgc gatcctcggc      1080
     gcgccggtga gcgtcgcggc gaccaccacg gacgggctcg gcctcaccgg gcgcggcgaa      1140
     gggcgtgccg ccgtcgcgaa cgcgctggtg taccccgcca gccccagaaa cgctaagatc      1200
     gccgggtga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page