(data stored in ACNUC7421 zone)

EMBL: CP001958.PE443

CP001958.PE443       Location/Qualifiers
FT   CDS_pept        complement(431859..433121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0449"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   rop:ROP_48670 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP- grasp (A)
FT                   domain; Phosphoribosylglycinamide synthetase, N- domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96936"
FT                   /db_xref="GOA:D6ZBV9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV9"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADG96936.1"
FT                   /translation="MRVLVIGSGGREHAFCIALKRDPAVSEIHAAPGNAGTARLAVNHT
FT                   VDVADPASVAHLAEQLEADLVIVGPEVPLVLGAADAVRAKGIACFGPSAQAAQIEGSKS
FT                   FAKDVMAAAGVRTARSETVDSTASLDAALDRFGPIWVVKDDRLAAGKGVVVTEDRAHAR
FT                   AHAVELLERGHPVLLESYLDGPEVSLFCLVNGDQVTPLQPAQDFKRAYSGDMGPNTGGM
FT                   GAYTPLPWLSQQTVDEIVDDIVCPVAVELLRRGCAYSGLLYAGLAIGSDGPAVVEFNCR
FT                   FGDPETQPVLALLRTPFGQLLRSVADGTFLETSELSWEPGYAVGVVLAAEHYPAKPHLG
FT                   DTITGALGEGLVLAGVDERDGALVSTGGRVLTAVGLGRDLTAARAQAYERMGGVHLPGG
FT                   HFREDIALAASNGEVTIPAKR"
     gtgagagtac tcgtcatcgg ctccggcggt cgcgagcacg cgttctgcat cgccctcaaa        60
     cgcgaccccg ccgtcagcga aatccatgcc gcgccgggca acgcgggcac cgctcgcctg       120
     gctgtgaacc acacggtgga cgtcgcggac cctgccagcg tcgcgcacct cgcggaacag       180
     ctcgaagcgg atttggtcat cgtcgggcca gaggtgccgc tggtgctcgg cgccgccgac       240
     gcggtccgcg cgaagggaat cgcctgcttc gggccttccg cgcaggcggc gcagatcgag       300
     ggctcgaaga gcttcgcgaa agacgtgatg gccgccgcgg gggtgcgcac cgcccgcagc       360
     gaaaccgtcg actcgaccgc gtcgttggac gcggcgctcg accggttcgg gccgatctgg       420
     gtcgtgaaag acgaccgcct cgcggcgggg aaaggcgtcg tcgtcaccga agaccgcgcg       480
     cacgcgcggg cacacgcggt cgaactgctc gaacgcggcc acccggtgct tttggagtcg       540
     tacctcgacg ggccggaggt ctcgttgttc tgcctcgtca acggagacca agtgacgccg       600
     ttgcagcccg cgcaggactt caaacgcgcc tacagcgggg acatggggcc gaacaccgga       660
     ggcatggggg cgtacacgcc gctgccgtgg ctctcgcagc agaccgtgga cgagatcgtg       720
     gacgacatcg tgtgcccggt cgcggtcgag ctgttgcgtc gcggttgcgc gtactcgggg       780
     ctgctctacg ccgggctcgc catcggaagc gacgggcccg ccgtggtgga gttcaactgc       840
     cggttcggcg atcccgagac gcaacctgtg ctcgctcttt tgcgcacccc gttcgggcag       900
     ctgctgcgct cggtcgcgga cggcacgttc ctggagacat cagagttgtc gtgggagccc       960
     ggttacgccg ttggcgtcgt gctcgccgcc gagcattacc ccgccaaacc gcatttgggc      1020
     gacacgatca ctggcgcgct gggcgaaggc ttggtcctcg ccggggtcga cgagcgggac      1080
     ggggcgttgg tctccacagg cggacgcgtc ctcacggcag tgggcctcgg tcgggatcta      1140
     acagccgccc gcgcgcaggc gtacgagcgg atgggcgggg tgcatctgcc gggtgggcat      1200
     ttccgggagg atatcgcgtt ggcggccagc aacggagaag tcaccatccc cgcaaagcgc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page