(data stored in ACNUC7421 zone)

EMBL: CP001958.PE445

CP001958.PE445       Location/Qualifiers
FT   CDS_pept        433812..434297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96938"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96938.1"
FT                   /translation="MLVVAIAVLGHRMWFPSAEPRTSNRDFEQAKANVIRVTAWVAGVA
FT                   RDAEGRGSKQGCRAGTLGEGPPWLWSQEYDLPYSEQTAHDLTARLRQLRDEGWSYVETK
FT                   PELEQVHTKLGVQVSNSEQVSIDAWRSSKVNIEDDAKAGVAPQQHTMSIIGLSECTN"
     gtgctggtcg tcgcgatcgc cgtgctcggc caccgcatgt ggttcccttc ggcggagcct        60
     cggaccagca accgtgattt cgagcaagcc aaagcgaacg tcattcgtgt gacggcgtgg       120
     gtcgcgggtg ttgcgcgcga cgccgaggga aggggctcga aacaaggctg ccgggccggg       180
     acgctcgggg aagggccgcc gtggctttgg tcgcaagagt acgacctgcc ttattccgag       240
     caaacggccc atgacctcac ggcccggctg cgccagttgc gcgacgaagg atggagttac       300
     gtcgagacca agcctgaact ggaacaggtc cacaccaagc tcggcgtgca ggtctccaac       360
     agcgaacagg tttccatcga cgcgtggcgc agcagcaagg tcaacatcga agacgacgcc       420
     aaggcgggcg tcgccccgca gcagcatacg atgagtatca tcggtctcag cgagtgcacg       480
     aactga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page