(data stored in ACNUC7421 zone)

EMBL: CP001958.PE446

CP001958.PE446       Location/Qualifiers
FT   CDS_pept        434362..435141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsm:HSM_1237 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96939"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96939.1"
FT                   /translation="MSATPEHPSRSKSNEYHFDIHGKPIDASWWATLQAMGAQYSLICR
FT                   SVVRGWLVTTEWTGKEWYLPKQGLPRIFRTNVHDPKGQNQYSAHWGSREEAADGHASVE
FT                   DMILRALRLAVEGPGDWDLDDEEAPDEEPRQIDGYYDIEGRLLTYEQFRALRALGSWYS
FT                   DVAPRERLYGWTVETMWTGWDRQEEDHPDERPMVVTTEVDCDYKHFARGGWPDANSARV
FT                   GHVQIRGLVGQFALGQLSREEMLVCFDALWTPRPRGG"
     gtgagcgcga caccggagca cccttcgcgc tcgaagtcga acgagtacca cttcgacatt        60
     cacggcaaac ccattgacgc gagctggtgg gcgaccctgc aagcgatggg ggcgcaatac       120
     tcccttatct gccgcagcgt ggtgcgcgga tggctggtca ccacggaatg gaccggcaaa       180
     gagtggtatt tgcccaaaca aggactgccc cggatcttcc gcaccaatgt gcacgacccg       240
     aaggggcaga accagtactc cgcgcattgg gggagccgtg aggaggccgc cgacggccac       300
     gcctcggtgg aggacatgat tctgcgcgcg ctgcgcctcg cggtggaggg gcccggcgac       360
     tgggacctcg acgatgagga ggcccccgac gaggagccgc gccagatcga cgggtactac       420
     gacatcgaag gacgactgct cacatatgag cagttccgcg ctttgcgcgc gctcggcagc       480
     tggtactccg acgtggcccc gagggagcgg ctttacggtt ggacggtcga aaccatgtgg       540
     accggatggg accgtcagga ggaagaccac ccggacgagc gcccgatggt ggtgaccacc       600
     gaggtcgact gcgactacaa gcatttcgcc cgaggcggtt ggcctgacgc caacagcgcc       660
     cgagtcggcc atgtccagat ccggggcctc gtcggccagt tcgctctcgg gcagctgtcc       720
     cgagaagaga tgctggtctg cttcgacgcc ctgtggaccc cgcgcccgcg cggcggttag       780
//

If you have problems or comments...

PBIL Back to PBIL home page