(data stored in ACNUC7421 zone)

EMBL: CP001958.PE449

CP001958.PE449       Location/Qualifiers
FT   CDS_pept        complement(437248..438063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0455"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: nfa:nfa18600 indole-3-glycerol-phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96942"
FT                   /db_xref="GOA:D6ZBW5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW5"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADG96942.1"
FT                   /translation="MSHTVLETIIAGVREDVAAREAAKDFAHIKRAAHAAPDPLDAAAA
FT                   LREAGVGVIAEIKRASPSKGALADIPSPADLARLYQEGGARAVSVLTEERKFKGSLADL
FT                   DEVRAAVSIPVLRKDFIVTTYQVHEARAHGADIVLLIVAALEQNALSSLLDRVESLGMT
FT                   ALVEVHDEQEAERALAAGASVIGVNARNLKTLEVDPETFARVVPALPAEVIKIAESGCK
FT                   SSADLLNYAAAGADAVLVGEGIVTAADPLAALTELVTAGTHPSCPRPVR"
     atgtcgcaca ccgttctcga gacgattatc gccggagtgc gggaagacgt cgccgcacgc        60
     gaggccgcga aggactttgc gcacatcaag cgggcggcgc acgccgcccc tgaccctttg       120
     gacgccgcgg cggcgttgcg cgaagcagga gtcggggtca tcgccgagat caagcgcgcc       180
     agccccagca aaggagcgct cgccgacatc ccgagccccg cagatctggc tcggctctac       240
     caagagggcg gcgccagggc ggtcagcgtc ctgaccgaag agcgcaagtt caaaggctcg       300
     ctcgcggacc tcgacgaggt ccgggctgct gtgagcatcc ccgtgctgcg caaagacttc       360
     atcgtgacca cctaccaagt ccatgaggcc cgcgcgcacg gggccgacat cgtgctgctc       420
     atcgtcgcgg ccttggagca gaacgcgctg agctcgctcc tcgaccgggt cgagagcctt       480
     ggcatgaccg ccctggtcga agtgcatgac gagcaagagg cagagcgcgc gctcgcagca       540
     ggggcaagcg tcatcggcgt caacgcccgg aacttgaaaa ccctcgaggt ggacccggag       600
     acattcgcca gagtcgtccc cgccctgccc gccgaagtca tcaaaatagc cgagtcgggc       660
     tgcaagagct ccgcggatct gttgaactac gccgcggcgg gagccgacgc tgtcctggtc       720
     ggcgagggca tcgtcacagc cgcagacccg ctcgcggcgc tcactgagct cgtcaccgcc       780
     gggacgcacc cgtcgtgccc ccggcccgtg cgatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page