(data stored in ACNUC7421 zone)

EMBL: CP001958.PE450

CP001958.PE450       Location/Qualifiers
FT   CDS_pept        complement(438139..438702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0456"
FT                   /product="Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp"
FT                   /note="PFAM: Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp; KEGG: rop:ROP_07410 hypothetical
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96943"
FT                   /db_xref="GOA:D6ZBW6"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW6"
FT                   /inference="protein motif:PFAM:PF09534"
FT                   /protein_id="ADG96943.1"
FT                   /translation="MKRPLAWASLLLVCAGAGAYGSSRATWAVASAHDGLGAPRDVRVL
FT                   GSDFAPLTIALALLLIAAVPAVFAVKGWTLRAVALAVGLAGAGLVWAGAHWLADKPDSA
FT                   QAARLAALPERYQVDHLVVSRTSGGLPLAAGAMALGACVFILRAARAAQGLGSRFDSPA
FT                   AKKDRPEVERSAWAALDAGEDPTL"
     gtgaagcgcc cgctggcgtg ggcctcgctc ctgctcgtgt gcgccggggc gggcgcgtac        60
     ggctcgtctc gggccacctg ggctgtggcc agcgcgcacg acgggctggg cgccccgcgc       120
     gacgtccgag tgctcggatc tgatttcgcg ccgctgacca tcgccctcgc gctgctcctg       180
     atcgccgccg tgcccgctgt gttcgcggtc aaaggctgga cattgcgcgc ggtggctctc       240
     gcggtcggcc tcgcaggagc cgggcttgtc tgggccgggg cgcactggct cgccgacaag       300
     ccggactccg cccaggcggc gcgattggcc gccctgcccg agcgctacca ggtcgatcat       360
     ctcgtggtga gcagaacatc cggggggctg cccctggccg cgggggcgat ggcgctcggc       420
     gcgtgcgttt tcatcctgcg cgccgcccgg gcggcgcagg ggctgggaag ccgattcgac       480
     tcgccagcgg cgaaaaagga ccgtcccgag gtggaacgct cggcgtgggc cgcgctcgac       540
     gcgggcgaag acccgacgct gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page