(data stored in ACNUC7421 zone)

EMBL: CP001958.PE451

CP001958.PE451       Location/Qualifiers
FT   CDS_pept        complement(438740..440305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0457"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; KEGG:
FT                   nfa:nfa18580 anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96944"
FT                   /db_xref="GOA:D6ZBW7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW7"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ADG96944.1"
FT                   /translation="MTVRALTGNAPSNTTTRAEFEALAQGRRVVPVARRLLADAETPVS
FT                   AFRKLAGERAGTFLLESAEQGKMWSQWSFIGVRTGATLTSAGERAVWRGTPPAGVPVEG
FT                   SPLAVLDQTVRALATDPVPGLPPLTSGLVGYLGYDAVRWVEQLPERTHDDLRLPTMTML
FT                   LVTDLAVFDHRANVITLIANAFLPASSATAPDQAGLDALYAEALARLDAMTADLAAHAP
FT                   STVSVFDWPTPDFSSQLTEEEYGQNVRKVVAEIEAGEAFQVVPSQRYSMPVHADPLDVY
FT                   RVLRVNNPSSHMYLMRVPAETGETAFHIVGSSPEALLTARGRTVTTRPIAGTQPRGRTN
FT                   EDDVLFEKKLTDDPKEQAEHLMLVDLGRNDLGRVCVPGSVRVAEFRVLERYSHVMHLVS
FT                   TVSGELAPGKTALDAVLACFPAGTLSGAPKVRAMEIIEEVEITRRGLYGGVVGYFDFAG
FT                   EADTAIAIRTAVVKDGVAYVQAGGGVVLDSDPSSEYRESRNKANTVLSAIAAAQTMRSP
FT                   NEAG"
     atgactgtca gggcactcac cggcaacgcc ccctccaaca cgaccacccg cgcagagttc        60
     gaggcgctgg cgcaggggcg gcgcgtggtc ccggtggccc gaaggctgct cgccgacgcg       120
     gaaaccccgg tctccgcgtt ccgcaaactc gcgggcgagc gcgcgggcac gttcctcctg       180
     gaatccgccg aacagggcaa aatgtggtcg cagtggtcgt tcatcggggt gcgcaccggc       240
     gcgacgctca cgtcggcggg cgagcgggcc gtctggcgcg ggacgccccc ggcgggggtg       300
     cctgtcgaag gctccccgct cgccgtgctc gaccagaccg tgcgagcgct cgccaccgat       360
     cccgttcccg gactgccgcc gctgaccagc ggcctcgtcg gctacctcgg ctacgacgcg       420
     gtgcgctggg tggagcagct gcccgagcgc acccacgacg acctgcggct gccgacgatg       480
     accatgctgc tcgtcaccga tctcgccgtc ttcgaccacc gcgcgaacgt catcaccctg       540
     atcgccaacg ctttcctgcc tgccagctcc gccacagcgc cggaccaagc cggcctggac       600
     gcgctgtacg ccgaggccct tgcccgcctg gacgcgatga ccgccgacct cgccgcgcac       660
     gctccgtcca ccgtgtccgt cttcgactgg ccgacccccg atttctcctc ccagctcacc       720
     gaagaggaat acgggcagaa cgtgcggaaa gtcgtggcag agatcgaagc gggcgaggcg       780
     ttccaagtcg tgccgtcgca gcgctacagc atgccggtgc acgcggaccc gctcgacgtg       840
     taccgggtgc tgcgggtgaa caaccccagc tcgcacatgt acctcatgcg ggtccccgcg       900
     gagacgggcg agaccgcgtt ccacatcgtc ggctcaagcc ccgaggcttt gctcaccgcc       960
     cgaggacgga ctgtgacgac ccggcccatc gcgggcaccc agccaagggg ccgcaccaac      1020
     gaggacgacg tcctcttcga gaaaaagctc accgacgacc cgaaagaaca agcagagcac      1080
     ctgatgctgg tcgacctcgg ccgcaacgac ctcggacggg tgtgcgtgcc gggcagcgtg      1140
     cgggtggccg agttccgggt cttggagcgc tacagccacg tcatgcacct cgtctcgacc      1200
     gtgagcgggg agctcgcgcc gggcaaaacg gcgctcgacg cggtgctcgc ctgtttcccc      1260
     gcaggcacgc tgtcgggggc tccgaaggtg cgggcgatgg aaatcatcga agaagtcgag      1320
     atcacccggc gcggcctcta cggcggcgtg gtgggctact tcgacttcgc gggcgaggcc      1380
     gacaccgcca tcgccatccg cacggccgtg gtcaaagacg gcgtcgccta tgtgcaggcc      1440
     ggcggcggcg tggtcctcga ctccgaccct tcctcggagt accgggagag caggaacaaa      1500
     gcgaacaccg tcctgtccgc catcgccgcc gcgcagacga tgcgctcgcc gaacgaggcc      1560
     ggatga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page