(data stored in ACNUC7421 zone)

EMBL: CP001958.PE452

CP001958.PE452       Location/Qualifiers
FT   CDS_pept        440369..440836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0458"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: nfa:nfa18570 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96945"
FT                   /db_xref="GOA:D6ZBW8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADG96945.1"
FT                   /translation="MALQVGDVVQDFELPDQTGAPRKLSEFLALGPVVVFFYPKASSPV
FT                   CTAQACQFRDLGAQFRELGAQRVGISKDSVSGQAGFVSGKSLDFPLLSDKAGVAAALFG
FT                   VKGGLGGLSPVKRSTFVLDQTGKVLKAIHHEFRGKAHADEALAFLQSVVAS"
     atggcgttac aagttggcga tgtggtgcag gacttcgagc tgcccgatca gacgggcgcg        60
     ccccgcaagc tcagcgagtt cctggctttg ggccctgtgg tggtgttttt ctacccgaag       120
     gcttccagtc cggtgtgcac cgcgcaagcc tgtcagttcc gcgacctcgg cgcgcaattc       180
     cgggagctcg gcgcgcagcg cgtcgggatc agcaaagact ctgtgtccgg tcaggccggg       240
     ttcgtctcgg gcaagtcgct ggatttcccg ctgctgtccg acaaggcggg cgtggccgcg       300
     gctttgttcg gggtcaaagg cgggctcggc gggctcagcc cggtcaagcg ttcgaccttc       360
     gtgctcgacc agaccggcaa agtcctcaag gcgattcatc acgaattccg gggcaaggcg       420
     catgcggacg aggcgttggc ctttttgcag tcggtcgtgg cctcatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page