(data stored in ACNUC7421 zone)
EMBL: CP001958.PE452
CP001958.PE452 Location/Qualifiers
FT CDS_pept 440369..440836
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Srot_0458"
FT /product="alkyl hydroperoxide reductase/ Thiol specific
FT antioxidant/ Mal allergen"
FT /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT antioxidant/ Mal allergen; KEGG: nfa:nfa18570 hypothetical
FT protein"
FT /db_xref="EnsemblGenomes-Gn:Srot_0458"
FT /db_xref="EnsemblGenomes-Tr:ADG96945"
FT /db_xref="GOA:D6ZBW8"
FT /db_xref="InterPro:IPR000866"
FT /db_xref="InterPro:IPR013766"
FT /db_xref="InterPro:IPR024706"
FT /db_xref="InterPro:IPR036249"
FT /db_xref="UniProtKB/TrEMBL:D6ZBW8"
FT /inference="protein motif:PFAM:PF00578"
FT /protein_id="ADG96945.1"
FT /translation="MALQVGDVVQDFELPDQTGAPRKLSEFLALGPVVVFFYPKASSPV
FT CTAQACQFRDLGAQFRELGAQRVGISKDSVSGQAGFVSGKSLDFPLLSDKAGVAAALFG
FT VKGGLGGLSPVKRSTFVLDQTGKVLKAIHHEFRGKAHADEALAFLQSVVAS"
atggcgttac aagttggcga tgtggtgcag gacttcgagc tgcccgatca gacgggcgcg 60
ccccgcaagc tcagcgagtt cctggctttg ggccctgtgg tggtgttttt ctacccgaag 120
gcttccagtc cggtgtgcac cgcgcaagcc tgtcagttcc gcgacctcgg cgcgcaattc 180
cgggagctcg gcgcgcagcg cgtcgggatc agcaaagact ctgtgtccgg tcaggccggg 240
ttcgtctcgg gcaagtcgct ggatttcccg ctgctgtccg acaaggcggg cgtggccgcg 300
gctttgttcg gggtcaaagg cgggctcggc gggctcagcc cggtcaagcg ttcgaccttc 360
gtgctcgacc agaccggcaa agtcctcaag gcgattcatc acgaattccg gggcaaggcg 420
catgcggacg aggcgttggc ctttttgcag tcggtcgtgg cctcatga 468
//
If you have problems or comments...
Back to PBIL home page