(data stored in ACNUC7421 zone)

EMBL: CP001958.PE454

CP001958.PE454       Location/Qualifiers
FT   CDS_pept        441213..441458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chl:Chy400_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96947"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96947.1"
FT                   /translation="MKKAAHVPVLVLSAFALTFAGLVKHEPVPVPPVPPAGGEDHGGAV
FT                   PDDTRPYIPRDDDDDDGDDDDSDRVEPSAPVIPPQS"
     atgaagaagg cagcgcatgt ccccgtcctc gtcctcagcg ccttcgcgct gactttcgca        60
     ggcctcgtca agcacgagcc agtgcctgtt ccccccgtcc cgcccgcggg cggggaggac       120
     cacggcggcg cggtccccga cgacactcgg ccgtacatac cgagggacga cgatgatgac       180
     gacggcgatg acgacgactc ggaccgggtc gagccgagcg cgccggtcat tcccccgcaa       240
     tcctga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page