(data stored in ACNUC7421 zone)

EMBL: CP001958.PE455

CP001958.PE455       Location/Qualifiers
FT   CDS_pept        441536..441847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0461"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: rer:RER_26320 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96948"
FT                   /db_xref="GOA:D6ZBX1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX1"
FT                   /inference="similar to AA sequence:KEGG:RER_26320"
FT                   /protein_id="ADG96948.1"
FT                   /translation="MFPASARRQKRLSAAVLALAAFGMVVTGGMSAAAASGGGYGPIPV
FT                   PVHPMPQSPPAGASPKAFHPVPAPHGTIPKPAPGSRSPRPAAPTVAPGAGVDDSDDDS"
     atgtttcccg cctccgctcg ccggcagaaa cgcctttcgg ccgcagtgct cgccttggcg        60
     gctttcggca tggtcgtgac cggcggcatg tccgccgctg ccgcctcggg gggaggctac       120
     gggcccatcc ccgtcccggt gcatcccatg ccgcagtccc cgcccgccgg agcgtcgccg       180
     aaagcgttcc atccggtgcc cgccccgcac ggcacgatcc cgaagcccgc tcccggcagt       240
     cgctcgcctc ggccggcagc gcccaccgtc gcgccgggtg caggcgtgga cgactccgac       300
     gacgactcgt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page