(data stored in ACNUC7421 zone)

EMBL: CP001958.PE459

CP001958.PE459       Location/Qualifiers
FT   CDS_pept        complement(444584..446131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0465"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; KEGG:
FT                   msm:MSMEG_3101 glucose-6-phosphate 1- dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96952"
FT                   /db_xref="GOA:D6ZBX5"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX5"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ADG96952.1"
FT                   /translation="MTKAALPPAGWTNPLRDERDKRMPRIAGPCGLVVFGVTGDLSRHK
FT                   LMPAVYDLANRGLLSPSFSLVGFGRRDWDDAGFADFVRDCVQAKARTPFREETFARLAQ
FT                   GMRFVQGAFDEDASFERIADALRGLDEDRGTGGNYAFYLSVPPKDFPVVFKHLSATGLA
FT                   HPPEGSWRRAVVEKPFGHDLESAIELNGVIKEVFDERSIFRIDHYLGKETVQNILALRF
FT                   ANQLFEPIWNAHYVDHVQITMAEDIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMEE
FT                   PVSFAAHEVTTEKTKVLSAAKLSYPLDETTARGQYARGWQGGQEVCGLLEEEGFASDST
FT                   TETFAAITVEVDSRRWAGVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDEAMTEELGQN
FT                   ALVIRVQPDEGVTLRFGSKVPGSAMRVRDVNMDFNYGQAFTESSPEAYERLILDVLLGE
FT                   PSLFPVTDEVELSWKILDPVLEHWGAGGAPEQYPSGGWGPKSATEMLARSGRTWRRP"
     atgaccaagg cggcgctccc gcctgccggg tggaccaacc cattgcgcga cgagcgcgac        60
     aaacgcatgc cgcgcatcgc gggcccgtgc ggcctcgttg ttttcggggt caccggggat       120
     ctctcgcgcc acaagctcat gcccgccgtg tacgacctcg cgaaccgagg cctgctctcc       180
     cccagcttct ccctggtcgg cttcggccgc agagactggg acgacgcggg cttcgcggac       240
     ttcgtccgag actgcgtgca ggccaaagcc cgcaccccgt tccgggagga aacgttcgcc       300
     aggctcgccc aaggcatgcg gttcgtccag ggagcctttg acgaagacgc ttccttcgag       360
     cggatcgccg acgcgttgcg cggattggac gaggaccggg gcacgggcgg caactacgcc       420
     ttctaccttt cggtgccgcc gaaagacttc ccggtcgtgt tcaaacacct ctccgccacc       480
     ggcctcgccc acccgccgga aggcagctgg cggcgcgcgg tcgtcgagaa gccgttcggg       540
     cacgacttgg agagcgccat cgagctgaac ggcgtgatca aagaggtctt cgacgagcgg       600
     tcgatcttcc gcatcgacca ctatctcggc aaagagaccg tgcagaacat cttggcgttg       660
     cggttcgcga accagctgtt cgagccgatt tggaacgcgc actacgtcga ccacgtccag       720
     atcaccatgg ccgaggacat cggcctgggc gggcgtgccg ggtactacga cgggatcggc       780
     gcggcgcggg acgtgatcca aaaccacctg ttgcagttgc tcgcgctggt cgcgatggag       840
     gagccggtga gtttcgcggc gcacgaagtc accacggaaa agaccaaagt gctctccgcc       900
     gcgaaactct cctacccttt ggacgagacc accgcgcgcg gtcagtacgc gcgcggctgg       960
     cagggcggcc aagaggtgtg cggcctgctg gaagaagaag gcttcgcgtc ggactcgaca      1020
     accgagacgt tcgccgcgat caccgtggaa gtcgactcgc gccgctgggc gggggtgcct      1080
     ttctacctgc gcaccggcaa acggctcggg cggcgcgtca ccgagatcgc gctggtcttc      1140
     aagcgcgccc cgcacttgcc cttcgatgag gcgatgaccg aagaactcgg gcagaacgcc      1200
     ctggtcatcc gtgtgcagcc ggatgaaggc gtcacccttc ggttcggttc gaaggtgccg      1260
     ggttccgcga tgcgggtgcg cgatgtgaac atggacttca actacgggca ggccttcacc      1320
     gagtcctcgc ccgaggccta cgagcggctt atcctcgacg tgctcctcgg cgagccctcg      1380
     ctgttccccg tgaccgacga ggtggagctg tcctggaaga tcctggaccc ggtccttgag      1440
     cattggggcg ctggcggcgc gccggagcaa tacccctccg gcggctgggg ccccaagagc      1500
     gcgaccgaga tgctggcccg cagcggccgg acctggaggc ggccatga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page