(data stored in ACNUC7421 zone)

EMBL: CP001958.PE46

CP001958.PE46        Location/Qualifiers
FT   CDS_pept        35011..35331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96539"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L2"
FT                   /inference="similar to AA sequence:KEGG:Mjls_2273"
FT                   /protein_id="ADG96539.1"
FT                   /translation="MWSDVAFTALPPGWVNVYRMDDGTYETEPCPGVLLQEATQYKECW
FT                   DEEVGGSNVLRTRRCEMDRETRTVPAEICVGNLSPACDVSNYVTTATAEEWEGQEAGEA
FT                   GE"
     atgtggagtg acgtcgcgtt cactgccctc cctccggggt gggtgaacgt ctacaggatg        60
     gacgacggca cctatgagac cgagccctgc cccggtgtgc tgctgcaaga ggcgacccaa       120
     tataaagaat gctgggacga ggaagtgggc ggcagtaacg tgcttcggac ccgtcggtgc       180
     gagatggacc gtgagacaag gaccgtgccc gccgaaatct gtgttggaaa cttgtcgcca       240
     gcctgcgatg tctccaacta tgtgacaacc gccacggctg aggaatggga gggccaagag       300
     gccggggagg ccggggaatg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page