(data stored in ACNUC7421 zone)

EMBL: CP001958.PE465

CP001958.PE465       Location/Qualifiers
FT   CDS_pept        complement(453687..454106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0471"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rha:RHA1_ro01573 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96958"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG96958.1"
FT                   /translation="MSDAPAFTTRWPVPTRWADNDHYGHVNNVAYYSYFDTAVNAWLMS
FT                   ETGMDTRELQAIGVVAETSCRYLRQLSFPDQLEVGIACERLGERSVVYRLAVFTAGDDE
FT                   PAALGRFAHVYVDAVTRTPVPVPEPVRQAVRRLGS"
     atgagcgacg cgcccgcctt cacgacccgc tggccggtgc ccacccgctg ggcggacaac        60
     gaccactacg ggcatgtgaa caacgttgcc tactactcgt atttcgacac agcggtgaac       120
     gcctggctga tgagcgagac cggcatggac actcgcgagt tgcaggccat cggcgtggtc       180
     gcggaaacct cgtgccgcta cctgcgccag ctcagcttcc ccgaccagct cgaagtgggc       240
     atcgcctgcg agcgcctcgg ggagcgcagc gtcgtgtacc ggctcgctgt tttcacagct       300
     ggcgacgacg agcccgccgc gctcggacgg ttcgcgcacg tctacgtcga cgctgtgacc       360
     cgcacgccgg tcccggtgcc cgagccggtc cggcaagcgg tgcggcggct cggctcctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page