(data stored in ACNUC7421 zone)

EMBL: CP001958.PE466

CP001958.PE466       Location/Qualifiers
FT   CDS_pept        complement(454103..455242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0472"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mab:MAB_0983c zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96959"
FT                   /db_xref="GOA:D6ZBY2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY2"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG96959.1"
FT                   /translation="MKTLAAVLRHEREPQPYAVSKPLALEEVDLAEPGPHELLVRIEAA
FT                   GVCHSDLSVINGHRPRPLPMALGHEAAGVVAAVGPDVRDVREGDHVVLVFMPSCGRCPA
FT                   CARRQPTLCAAAAKANSAGSLLSGGRRITDAIGGSLHHHLGVSGFAQHAVVDRSSAVVV
FT                   DRDLPMDIAALFGCAMLTGFGAVRNTAAVAPGESVAVIGLGGVGLAAVLGAKAAQAAPV
FT                   IAIDPVPAKRELALQLGATHAAAPQDAAAVVADATGGLGVRWAFEAAGKAAVMRQAFEL
FT                   AGRGGAAVFIGLPPSTEELALPAVSFVGESKSAIGSYMGSADPQQDVPALIGLWRDGAL
FT                   PVEKLKSHTLALADLNEAMDRLADGSAVRQVILPHGRGA"
     atgaaaactc tcgccgctgt gctgcgccac gagcgcgaac cgcaacccta cgccgtttcc        60
     aagccgcttg cgctcgaaga ggtggacctc gccgagccag gcccgcacga gctgctggtg       120
     cgcattgagg ccgccggggt ctgccactcc gatctttccg tcatcaacgg ccaccggccc       180
     cgtcctttgc cgatggccct cgggcacgag gcggctggtg tcgtcgccgc cgtcgggccg       240
     gacgtgcggg acgtgcgcga gggcgaccat gtggtgctcg tcttcatgcc cagctgcggc       300
     cggtgccccg cgtgcgcgcg gcgacagccc accctgtgcg cggcggcggc caaagccaac       360
     agcgcgggct ctttgctttc cggcggacgc agaatcaccg acgcgatcgg cggctccctg       420
     caccaccacc tcggggtgtc cggattcgcc caacacgctg ttgtggaccg gtcttccgcc       480
     gtcgtcgtcg accgcgacct gcccatggac atcgccgcgc tcttcggttg cgcgatgctc       540
     accggcttcg gggctgtgcg caacaccgcc gccgtcgcgc cgggagaaag cgtggcggtc       600
     atcgggctcg gcggcgtcgg tttggccgca gtgctcggag caaaagccgc gcaggcagca       660
     cctgtcatcg cgatcgaccc agtcccggcg aaacgggagc tcgctctgca gctgggcgcg       720
     acccacgccg cggccccgca ggacgcggct gccgtggtcg cggacgccac gggcggcctg       780
     ggcgtccggt gggcgttcga agcggcaggc aaggccgccg tcatgcggca agcattcgaa       840
     ctggcgggca ggggaggcgc cgccgtgttc atcgggctgc cgccctcgac cgaagaactc       900
     gccttgcccg ccgtctcctt cgtcggcgag tccaaatccg ccatcggctc gtatatgggt       960
     tcggcggacc cgcaacagga cgtccccgcc ctcatcgggc tctggcggga cggcgccctg      1020
     cccgtggaga agctcaagag ccacaccctc gccttggcgg acctgaacga ggcgatggac      1080
     cgcctcgccg acgggagcgc cgtgcggcaa gtgatactcc ctcacgggag gggcgcatga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page