(data stored in ACNUC7421 zone)

EMBL: CP001958.PE468

CP001958.PE468       Location/Qualifiers
FT   CDS_pept        455953..457539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0474"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: mjl:Mjls_3521 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96961"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY4"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADG96961.1"
FT                   /translation="MKPGTDKTKPEKSAKSSQSQSQSKGGQRQSQTQGGGAQLDGAFED
FT                   YTESPGFEKNFDEMFEQDGSARAPYRGVFQALEPLDSDDLNARAEALGRAFINQGITFS
FT                   LSGQERPFPLDLVPRVIAAAEWAKLEKGITQRVRALEAFLDDVYGDQEILRDGVIPRSL
FT                   IFSCQHFHRQASGIRPPNGVRIHVAGIDIIRDGQGTFRVLEDNLRNPSGVSYVMENRRT
FT                   MTRVFPDLFGTHRVRPVDDYPAHLLRALRAAAATNEDDPTVVVLTPGVANSAHFEHSLL
FT                   ARQMGVELVEGRDLFCRDNIVYMRTTEGEVQVDVIYRRIDDEYLDPLQFKPESLLGVAG
FT                   IVNAARAGNVVISSAVGNGVGDDKLVYTYVPSMIEYYLGEKPLLANVDTYRCWIPHELE
FT                   QTLDRINELVLKPVEGSGGYGIVFGPDASEKELAAMSRKIRANPRDWVAQPVMQLSTVP
FT                   TKIGDKVAPRHVDLRPFAVNDGENVWVLPGGLTRVALKEGSLVVNSSQGGGSKDTWVLG
FT                   NRSQAKTEVAS"
     gtgaagccag gcactgacaa aacaaagccg gagaaatcgg ccaagagcag ccagtcgcaa        60
     tcgcagtcca agggcggtca gcgccagtcc caaacgcagg gcggcggagc ccagttggac       120
     ggcgccttcg aggattacac cgagtcgccg gggttcgaga agaacttcga cgagatgttc       180
     gagcaggacg gctccgccag agccccgtat cggggcgttt tccaggcgtt ggagccattg       240
     gactccgacg acctcaacgc ccgcgcggaa gcgctcggca gggccttcat caaccaaggc       300
     atcaccttct cgctctcggg gcaagagcgg cccttcccgc tcgacctcgt gccccgcgtc       360
     atcgcagcgg cggaatgggc caagctggag aaggggatca cccagcgggt ccgcgccttg       420
     gaggcgttcc tcgacgatgt gtacggagac caggaaatcc tgcgcgacgg cgtcatcccg       480
     cgctcgctga tcttctcctg ccagcacttc caccgccaag cctcgggcat ccggccgccg       540
     aacggcgtgc gcatccacgt cgcgggcatc gacatcatcc gcgacggcca aggaacgttc       600
     cgggtgctgg aggacaacct gcgcaacccg tccggcgtga gctatgtgat ggagaaccgg       660
     cgcaccatga cacgggtctt ccccgacctc ttcggcacgc accgcgtccg cccggtggac       720
     gactaccccg cgcatttgct gcgcgccctg cgggccgccg cggccaccaa cgaggacgac       780
     ccgaccgtgg tggtgctcac ccccggcgtc gcgaactccg cgcacttcga gcactccctg       840
     ctcgcccggc aaatgggcgt cgagctggtc gaaggccgcg atcttttctg ccgggacaac       900
     atcgtctaca tgcgcaccac cgaaggcgaa gtccaggtcg acgtcattta ccggcgcatc       960
     gacgacgagt atctcgaccc gttgcagttc aaacccgagt ccctgctcgg cgtcgcgggc      1020
     atcgtgaacg cggcgcgggc cgggaacgtc gtcatctcct ccgcggtcgg caacggggtc      1080
     ggggacgaca agctggtcta cacctacgtg ccgtcgatga tcgagtacta cctcggcgag      1140
     aagcccctgc tcgcgaacgt ggacacctac cgttgctgga taccgcacga gctggagcag      1200
     accttggacc ggatcaacga gctcgtgctc aaacctgtgg agggctcggg cggctacggc      1260
     atcgtcttcg ggccggacgc gtcggagaaa gagctcgccg ccatgtcccg caaaatccgc      1320
     gccaaccccc gggactgggt cgcccagccg gtgatgcagc tgtccacggt cccgaccaaa      1380
     atcggcgaca aagtcgcccc acgccacgtg gacctgcgcc cgttcgcggt caacgacggc      1440
     gagaacgtgt gggtgctgcc cggaggcctc acccgagtgg ccctcaaaga gggctcgctg      1500
     gtggtgaact ccagccaagg cggcggcagc aaggacacat gggtgctggg caaccgctcc      1560
     caggcgaaga cggaggtggc ctcgtga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page