(data stored in ACNUC7421 zone)

EMBL: CP001958.PE469

CP001958.PE469       Location/Qualifiers
FT   CDS_pept        457640..458611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0475"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   rer:RER_37650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96962"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY5"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADG96962.1"
FT                   /translation="MLARNAESLFWIGRYVERADDTARILDVGVHQLLEDATVDSDQQA
FT                   RGLLRILGITPPEGEELHVWSMTDLVAFDRENGNSIADSLYRARENARGAREVTSTEMW
FT                   ESLNTTFNGIADSEKLARKLGPHEFFSYVENRAALFSGLVDSTLSRDDGYLFLLLGKHL
FT                   ERIDMGIRLLLVGSGDRSDASWVSVLRAAGAHDTYLRTYRGLLNSTSVVEFLVLDRLFP
FT                   RSVFYSLHRVEECLAELDRGDLYSRVGSRNEARRIIGSARSALEYTRASDLVDDLYARL
FT                   SSVQSACLETGEAVADRYFTVEPYMLWSDVRAIGRAGGEEVA"
     atgttggccc gcaatgctga gtcgttgttt tggatcggac ggtacgtcga gcgggccgac        60
     gacaccgcgc gcattctgga cgtcggggtg caccagctcc tcgaagacgc gacggtggac       120
     tcggaccagc aggcccgcgg cctgctgcgg atcctgggca tcaccccgcc ggagggcgaa       180
     gagctccacg tctggtcgat gaccgacctc gtcgcgttcg accgggagaa cggcaactcc       240
     atcgcggatt cgctctaccg ggcgcgcgag aacgcccgag gggcgcgcga ggtcacctcc       300
     acagagatgt gggagagcct gaacaccacc ttcaacggca tcgcggacag cgagaagctc       360
     gcccgcaagc tcggcccgca cgagtttttc tcgtacgtgg agaaccgggc ggcgttgttc       420
     tccggcctgg tggactcgac cctctcccgc gacgacggct acttgttcct cctgctcggc       480
     aagcatcttg agcggatcga catgggcatt cgcctgttgc tggtcggctc gggcgaccgc       540
     tcggacgcgt cctgggtttc ggtgctgcgc gcggcaggag cccacgacac ctacttgcgc       600
     acgtaccggg gtttgctcaa ctccacctcg gtcgtcgagt tcctcgtcct cgaccgcctc       660
     ttcccccgct cggtcttcta ctcgctgcac cgggtggagg aatgcctcgc cgaactggac       720
     cgaggagact tgtactccag ggtcggctcg cgcaacgagg cgcgcaggat catcggcagc       780
     gcgcgcagcg cgctggagta cacgcgggct tccgacttgg tcgacgacct ttacgcgcgg       840
     ttgtccagcg tgcaatcggc ctgcttggag accggcgagg ctgtcgccga ccgatatttc       900
     acggtggagc cttacatgct gtggagcgat gtgcgcgcaa ttgggcgcgc gggaggggag       960
     gaagtcgcat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page