(data stored in ACNUC7421 zone)

EMBL: CP001958.PE47

CP001958.PE47        Location/Qualifiers
FT   CDS_pept        35328..35798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1817 putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96540"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96540.1"
FT                   /translation="MNAQELKEFIDEHMAQDWLILVNEMTGAALVADLAITSAEGFIRL
FT                   SGRITPDFYRFDPETGRLAHERYSLELMRGWRAVKPGSPEYEAAMRLNTARIKARAVFD
FT                   QLGAGDMTMIETRWPVIRAAMSNVSEAAAHIAAADEYGELLRRQETIKEAGA"
     atgaacgctc aagagttgaa agagttcatc gatgagcaca tggcgcaaga ctggctgatc        60
     ttggtgaacg agatgaccgg ggccgcgctc gtggcggact tggccatcac gagcgccgag       120
     ggctttatca ggctctcggg caggatcacg cctgactttt acaggttcga ccctgagact       180
     ggtcggctcg cgcatgagcg gtactcgctt gaactcatga gaggttggcg cgcggtgaag       240
     cctggcagcc cggagtacga ggcggcgatg cgcttgaaca ctgcacggat caaagcgcgg       300
     gcggtgttcg accagttggg cgcgggcgac atgaccatga tcgagacacg ttggccggtg       360
     atcagggccg cgatgtccaa cgtttcggag gctgcggcgc atattgcggc ggcggatgag       420
     tacggggagc ttctacggcg gcaggagacc atcaaggagg ccggggcatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page