(data stored in ACNUC7421 zone)

EMBL: CP001958.PE473

CP001958.PE473       Location/Qualifiers
FT   CDS_pept        461437..462645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0479"
FT                   /product="lipid-transfer protein"
FT                   /note="KEGG: mva:Mvan_2338 lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96966"
FT                   /db_xref="GOA:D6ZBY9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY9"
FT                   /inference="similar to AA sequence:KEGG:Mvan_2338"
FT                   /protein_id="ADG96966.1"
FT                   /translation="MAARKGKRVFVIGVGMTKFEKPGRREDWDYPDMARESGANALADA
FT                   GIPYADVEAASVGYVYGESTSGQRAVYELGMTGVPVVNVNNNCSTGSTALCLAAQQIRG
FT                   GLNDCVLALGFEKMQPGSLGATYDDREQPMERHIMALAEISEVLFPPAPWMFGAAGREH
FT                   MKLYGTTAEHFAKIGEKNHRHSVNNPNSQFRDEHTLDDILAARMIYDPLTKLQCSPTSD
FT                   GSAAAILASEDFVDQHGLADRAVEIVGQAMTTDFQSTFDGTAKNIVGFDMSRQAAREVY
FT                   EQSGLGPEDFQVIELHDCFSTNELLTYEALGLCPEGEGGKLVDSGETTYGGKWVVNPSG
FT                   GLISKGHPLGATGLAQCAELTWQLRGEADKRQVSGVAAALQHNIGLGGAAVVTAYQRAT
FT                   GPR"
     atggcggcgc gcaaaggcaa aagggttttt gtcatcggtg ttgggatgac gaagttcgag        60
     aagccggggc ggcgcgagga ctgggactac ccggacatgg cgcgtgaatc cggcgccaac       120
     gcgctcgccg acgcgggaat cccctacgcc gacgtcgagg ccgccagtgt cggatacgtc       180
     tacggcgagt ccacgtccgg ccaacgcgcc gtctacgagc tcggcatgac aggcgtcccg       240
     gtggtcaacg tcaacaacaa ctgctcgacc ggctcgacgg cgctctgcct cgcggcgcag       300
     cagatccgag gcggcctgaa cgactgtgtg ctcgcgctcg gattcgaaaa gatgcagccc       360
     ggctcgctcg gagccaccta cgacgaccgc gagcagccga tggagcgcca catcatggcc       420
     ctcgccgaaa tctccgaagt gcttttcccg cccgcgccgt ggatgttcgg cgcggcgggc       480
     cgtgagcata tgaagctgta cggcaccacc gccgaacact tcgcgaagat cggcgagaag       540
     aaccaccgcc actcggtgaa caaccccaac tcgcagttcc gcgacgagca caccctcgac       600
     gacatcctcg ccgcgcgcat gatttacgac ccgctcacca aattgcaatg ctcgccgacc       660
     tccgacggct cggccgccgc gatcctcgcc agcgaggact tcgtggacca gcacggcctc       720
     gcggaccggg cggtcgaaat cgtcggccag gccatgacca cggacttcca gtcgaccttc       780
     gacggcaccg cgaagaacat cgtcggcttc gacatgtcca ggcaggccgc gcgcgaagtc       840
     tatgagcagt ccggcctcgg gccggaggat ttccaagtca tcgagctgca cgactgcttc       900
     tccaccaacg aactcctgac ctacgaggcg ctcggcctgt gccccgaggg cgaaggcggc       960
     aagctggtgg actcgggcga gaccacgtac ggggggaaat gggtcgtcaa cccctccggc      1020
     gggctcatct ccaagggcca cccgctcgga gccaccggcc tcgcccaatg cgccgagctg      1080
     acctggcagt tgcgcggcga agccgacaag cgccaagtct cgggcgtggc cgccgccctg      1140
     cagcacaaca tcggcctcgg cggcgccgcg gtcgtcaccg cgtaccagcg ggccaccggg      1200
     ccccgctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page