(data stored in ACNUC7421 zone)

EMBL: CP001958.PE476

CP001958.PE476       Location/Qualifiers
FT   CDS_pept        464066..464935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0482"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rha:RHA1_ro05061 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96969"
FT                   /db_xref="GOA:D6ZBZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96969.1"
FT                   /translation="MGALDGRVAVVTGAGRGIGREHALLFAKEGAKVVVNDLGGANDGT
FT                   GADAGPAAEVVQEILALGGEASANTNNIADWDGAKDLVDQAVRDFGRLDVVVNNAGILR
FT                   DGFIAGMTEAQWDAVVAVHLKGHFNVLRHASAYWKEESKAGRQPNASVINTASDSGLTV
FT                   PNDGQGNYGAAKAAIAALTQVAASELERYGVRANAIAPMARTRLTLATPGMGAIFAEEV
FT                   EEGEFDGFSPANISPLVAYLATADCTITGKVFRVGGGYIAELGGWHEVNSYETDGPWSV
FT                   ELVAKQLA"
     atgggagcac tggacggacg tgtcgcggtc gtcaccggag ccggtcgcgg catcggccgc        60
     gagcacgcgc tcttgttcgc caaggaaggc gccaaagtcg tggtcaacga cctcggcggc       120
     gcgaacgacg gcaccggggc cgacgccggc cccgccgccg aagtcgtcca agagatcctc       180
     gccctcggcg gggaggcttc ggccaacacg aacaacatcg cggactggga cggcgcgaaa       240
     gacctcgtcg accaggcggt ccgcgacttc ggacggctcg acgtggtcgt caacaacgcg       300
     ggcatcctgc gcgacggctt catcgcgggg atgaccgaag cccaatggga cgcagtcgtc       360
     gccgtgcacc tcaaggggca cttcaacgtc ctgcgccacg cctcggcgta ttggaaagag       420
     gagagcaagg cgggccgtca gcccaacgcc tcggtcatca acaccgcgtc ggactccggc       480
     ctcacggtcc ccaatgacgg ccaaggcaac tacggagccg ccaaagcggc cattgcggcg       540
     ctcacccagg tcgccgcgag cgagctggag cgctacggcg tgcgggcgaa cgccatcgcg       600
     ccgatggcgc gcacccggct caccctcgcg acccccggca tgggcgcgat cttcgccgaa       660
     gaggtcgaag agggcgagtt cgacggcttc tccccggcga acatctcccc gctcgtcgcg       720
     tacttggcca cggcggactg caccatcacc ggcaaggtgt tccgggtcgg cggcggctac       780
     atcgccgagc tcggcggctg gcacgaagtg aactcctatg agaccgacgg cccgtggtct       840
     gtggagttgg tcgcgaagca gctggcgtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page