(data stored in ACNUC7421 zone)

EMBL: CP001958.PE482

CP001958.PE482       Location/Qualifiers
FT   CDS_pept        complement(469976..470617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0488"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: afo:Afer_1435
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96975"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ8"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADG96975.1"
FT                   /translation="MKTQRCYSCPMARRSVSILLFDGFELLDVFGPAELLSALPDDFAL
FT                   SFLGPSRAPVASAQGVSVNPDRTYEPAAASDILLLPGGAGTRPLVSDEKFLDILREHAS
FT                   RAGIVASVCTGSLVLAAAGLLDGYRATSNKSLFSFVSQHGQNVTWEPRARWVEDRDRWT
FT                   SSGVAAGMDMTIALIRSLCGDAAAKTAADDSEIEPQLDPSHDPFADLYGL"
     gtgaaaacgc agcgctgcta cagttgcccc atggcgcggc gatcggtctc gattctcttg        60
     ttcgacggtt ttgaactgct cgacgtgttc ggcccggccg agttgctcag cgccctcccg       120
     gatgatttcg ccctctcgtt cctgggcccg tctcgtgcgc cggtggcgag cgcgcaaggg       180
     gtgagcgtga accccgaccg cacctatgaa cccgctgccg cgagcgatat cctgctgctc       240
     cccggcggcg ccgggacgcg gccgctcgtg tccgacgaaa agtttctcga catcttgcgc       300
     gagcatgcct cgcgcgccgg gatcgtcgcc tcggtgtgca ccgggtcgtt ggtgctggcg       360
     gcggccggac tgctcgacgg ctaccgcgcc acatccaaca aatccctgtt ctcctttgtg       420
     tcgcagcacg gccagaacgt gacgtgggag ccgcgcgccc gctgggtcga ggaccgagac       480
     cgctggacgt cctcgggcgt ggcggcgggc atggacatga ccatcgccct gatccggtcg       540
     ctctgcggcg acgcggcggc gaagaccgcg gccgatgaca gcgaaatcga accgcagctg       600
     gatccgtccc acgacccttt cgcggacttg tacgggctct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page