(data stored in ACNUC7421 zone)

EMBL: CP001958.PE483

CP001958.PE483       Location/Qualifiers
FT   CDS_pept        471087..471662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0489"
FT                   /product="chorismate mutase"
FT                   /note="KEGG: mkm:Mkms_2781 chorismate mutase; TIGRFAM:
FT                   chorismate mutase; PFAM: Chorismate mutase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96976"
FT                   /db_xref="GOA:D6ZBZ9"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ9"
FT                   /inference="protein motif:TFAM:TIGR01806"
FT                   /protein_id="ADG96976.1"
FT                   /translation="MTMGALSKTVAAFLVAGAFACGPVPAAMANGVAAELVVQAAADRL
FT                   AVSSDVAASKWFSGGAIHDQARADDVLEDAAEQGSAAGLDQDRVRALFEDQIAAAEGEE
FT                   YARFAEWSFDPRSAPQAPTDLSSARARINEASSRLIQAYAQFAQKTAAKPACGAQVRAA
FT                   LAAEVSRRGWGAQWARGMRRAATHFCTG"
     atgacgatgg gcgctttatc gaaaacagtg gcggctttcc tcgtggcggg cgcattcgcg        60
     tgcggtcccg ttcctgcggc gatggccaac ggcgttgctg ccgagctcgt ggtccaggcg       120
     gccgccgacc gtctcgccgt ctcctccgat gtggccgcgt ccaagtggtt ctctggcgga       180
     gccatccacg atcaggccag ggcggatgac gtcctagagg acgcggcgga gcaaggctcg       240
     gcggccgggt tggaccagga ccgggtgcgg gctttgttcg aggaccaaat cgcggcggca       300
     gagggcgagg agtacgcgcg gttcgccgag tggtcgttcg acccgcgctc ggctccccaa       360
     gccccgaccg atctctccag cgcgcgggcg cgcatcaacg aagcctcgag ccgtttgatc       420
     caggcgtacg cccagttcgc ccagaaaacg gcggccaaac ccgcgtgcgg cgcccaggtg       480
     cgagcagcgc tcgccgccga ggtctcccgg cgaggatggg gagcacaatg ggcgcgcggg       540
     atgcgccgcg ccgccacgca tttctgcact ggctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page