(data stored in ACNUC7421 zone)

EMBL: CP001958.PE485

CP001958.PE485       Location/Qualifiers
FT   CDS_pept        complement(472744..473250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Pc12g08860"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96978"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96978.1"
FT                   /translation="MTTEEEAAAAKARAENLLGATENQFAEAVALRKDLMQIIGKGQSP
FT                   DKLAQARCGADGVLVTFRFDRERAPKVDLAHLEKAVVQAAKAATHDARKQALEAMADFR
FT                   KHLGELPTPGEILAEVLPDANIEYDKLPVSPMRRVTKAMMHEPEYEEDDDPSYGRPNGW
FT                   GVQKK"
     atgacaacag aagaagaggc cgctgcggcg aaggcccgcg ccgagaatct cctcggggcc        60
     acggagaacc agttcgccga agccgtggcg ctgcgcaagg atctgatgca gatcatcgga       120
     aaaggccaga gccccgacaa gctcgcgcaa gcgcggtgcg gcgcggacgg cgtgctcgtc       180
     acgtttcgct tcgaccggga gcgggcgccg aaggtcgatt tggcccacct tgagaaagcg       240
     gtcgtgcagg cggcgaaagc agccacccac gacgcgcgga agcaggcttt ggaagccatg       300
     gccgatttcc gcaaacacct gggggaactg cccaccccgg gggagattct cgccgaggtc       360
     ctgccagacg cgaacattga gtacgacaag ttgccggtct cgccaatgcg cagggtgacc       420
     aaggcgatga tgcacgagcc tgagtacgaa gaagacgatg atccctcgta cgggcgcccg       480
     aacgggtggg gcgttcaaaa gaaatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page