(data stored in ACNUC7421 zone)

EMBL: CP001958.PE490

CP001958.PE490       Location/Qualifiers
FT   CDS_pept        479082..479561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96983"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96983.1"
FT                   /translation="MSIRLTFLFATCVLGLAGCAFSGDKDGATGGKAEPAQHKHPSSTA
FT                   EICSFFKKAHTKLSAQYAEFESKTLDSHWTWSDDSVSQLGSALAPLLRREAEDIQQSVS
FT                   ESATGPVAAQVKDLAEQDVHLAEKIEGRTFQGSIETSERLVDATVKSVKSICAIH"
     atgtccatac ggctcacttt tttattcgcc acctgcgtcc tggggttagc tggatgcgct        60
     ttctccggcg acaaggacgg agcaaccgga ggcaaagccg aacccgctca gcacaagcac       120
     ccgtcctcga ccgcagagat ttgcagtttt ttcaagaagg cgcacaccaa gctttcggcg       180
     cagtatgcgg aattcgaaag caaaaccctg gactcgcatt ggacatggtc ggacgacagt       240
     gtcagccagc ttggctcggc tctcgcgccg ctcctgcgaa gagaagccga agacatacaa       300
     caatctgtct cagaaagcgc cactgggccg gttgccgccc aagtcaaaga cctcgccgag       360
     caggatgtcc atctcgccga gaaaattgag ggacgaactt tccaagggtc gatcgagaca       420
     tcggaaagac ttgtcgacgc cacggtgaag tcagtgaaat ccatatgcgc gatccactag       480
//

If you have problems or comments...

PBIL Back to PBIL home page