(data stored in ACNUC7421 zone)

EMBL: CP001958.PE493

CP001958.PE493       Location/Qualifiers
FT   CDS_pept        complement(480542..480874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_08040 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96986"
FT                   /db_xref="GOA:D6ZC09"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96986.1"
FT                   /translation="MDIFAQAVASLVSALNSLLEFLLDKLIIMGISLAAGAITAETGVG
FT                   ALVGGLFALSQAFEAEAKWKDILKAIDSGWALVNGFIGTSVSACADLTGLTSQMAPGGT
FT                   YEHPEA"
     gtggatatat tcgcacaggc ggtcgcctct ctggtgagtg ccctgaacag cctgctggag        60
     ttcctcctgg acaagctcat catcatgggg atttccttag cggcaggagc cataactgca       120
     gagacggggg tcggagctct cgttggcggt ttgttcgcgc tttcgcaagc ctttgaagca       180
     gaggcgaagt ggaaagatat actcaaggca atcgacagcg ggtgggcatt ggtgaacgga       240
     ttcatcggca ccagcgtgag cgcgtgcgca gacctgaccg gcctgaccag ccaaatggct       300
     cccggtggca catacgagca tccggaggct tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page