(data stored in ACNUC7421 zone)

EMBL: CP001958.PE499

CP001958.PE499       Location/Qualifiers
FT   CDS_pept        complement(486798..487781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0508"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mpa:MAP0924
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96992"
FT                   /db_xref="GOA:D6ZC15"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC15"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADG96992.1"
FT                   /translation="MAENENSLSTLPRPGMPHTAVVPAAGMGTRFLPVTKSVPKELLPV
FT                   VDTPGIELVAAEAAQAGAQRLVIVTSEGKDSVVAHFVEDLVLESALEAKGKSAMLEKVR
FT                   RAPKLIKVESVIQHQPLGLGHAIAQVEPLLHPDDDAIAVLLPDDLVLKSPQQVAQERER
FT                   DICDQIEIREKVGALNLMAQVRAEHGGSVICAFPVPREEISAYGVFDVVEQEGPVRRVR
FT                   GLVEKPPAEKAPSNLAVAGRYILERAIFDALREVAPGAGGEIQLTDAIALLIDRGRPVH
FT                   LVVWDGYRHDLGNPGGYLKASIDFALDREEYGPGLRAWLISRLGLS"
     atggctgaga acgagaattc cctctccacc cttcctcgcc ctggcatgcc ccacaccgcg        60
     gtggtccccg ccgccggcat gggcacccgc ttcctccccg tgaccaagtc agtcccgaaa       120
     gaactcctgc ccgtggtgga caccccgggg atcgaactcg tggccgccga ggccgcccag       180
     gccggggcgc agcgcctggt catcgtcacc tccgagggca aagactccgt tgtcgcccac       240
     ttcgtcgaag accttgtgct cgaaagcgcg ctggaggcca aaggcaaatc ggccatgttg       300
     gagaaagtgc gccgcgcccc caagctcatc aaggtcgagt cagtcatcca acatcaaccg       360
     ctcgggctcg gccacgccat cgcccaagtc gaacccttgc tgcatccgga cgacgacgcg       420
     atcgcggtcc tgctgcccga cgacctcgtg ctcaaatccc cgcaacaagt ggcgcaggag       480
     cgcgagcggg acatctgcga ccagatcgaa atccgcgaga aggtgggcgc gctcaatctc       540
     atggcgcaag tgcgtgccga acacggcggc agcgtcatct gcgcgttccc ggtcccgcgt       600
     gaggagatca gcgcgtacgg cgtcttcgac gtcgtcgaac aggaaggccc ggtgcgccgt       660
     gtgcgcggcc tggtcgagaa accgcccgcc gagaaggccc cgtcgaatct ggccgtcgcg       720
     ggacggtaca tcttggaacg ggccatcttc gacgccctgc gcgaagtcgc cccaggggcg       780
     ggcggagaga tccagctcac cgatgcgatt gccctgctca tcgaccgagg ccgccctgtg       840
     catctcgtgg tctgggacgg ctaccgccac gacctcggca accccggcgg ctacctgaaa       900
     gcctcgatcg atttcgcatt ggaccgagaa gagtacggcc ccggcctgcg cgcttggttg       960
     atcagccggc tcgggctgag ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page