(data stored in ACNUC7421 zone)

EMBL: CP001958.PE50

CP001958.PE50        Location/Qualifiers
FT   CDS_pept        36795..37106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96543"
FT                   /db_xref="GOA:D6Z9L6"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L6"
FT                   /inference="similar to AA sequence:KEGG:Adeh_1911"
FT                   /protein_id="ADG96543.1"
FT                   /translation="MSRDEFWTGPVSFWTMTGAGFVCAALAGFFAAQGKWPLALYFAFA
FT                   AIVYLCWVKYRRVDDSRRAFEDGRRYTVDEVARMRRVLWESRPQVSYTYAPGESEESA"
     atgagccgcg atgagttctg gaccggccca gtgtcgttct ggacgatgac cggggcgggg        60
     ttcgtgtgcg ccgcgctcgc tgggtttttc gccgcgcaag ggaaatggcc gctggccctg       120
     tatttcgcgt tcgcggccat cgtctacctg tgctgggtca aataccggcg tgtggacgac       180
     tcgcgccgcg cgttcgagga cggcaggcgt tacacggtcg atgaggtcgc ccggatgcgg       240
     cgagtgcttt gggagtcccg accacaggtg tcttacacat acgcgccggg tgaaagcgag       300
     gagtccgcat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page