(data stored in ACNUC7421 zone)

EMBL: CP001958.PE500

CP001958.PE500       Location/Qualifiers
FT   CDS_pept        488006..488560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0509"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="KEGG: svi:Svir_32680 5,10-methenyltetrahydrofolate
FT                   synthetase; TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96993"
FT                   /db_xref="GOA:D6ZC16"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC16"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ADG96993.1"
FT                   /translation="MGPQSSAQRKAALRAQTRSARRALSDAQRAARDRAVDAQAARIAE
FT                   RFGPGDVVSSYVPTSLEPGSDRMLAAFADRGASVLVPVVVGVDAALAWRHWPEEGQDAP
FT                   PGALAEAAVVLVPALAVDRRGVRLGQGGGHYDRSLAEAGPGAMLVAVVDDRELVDELPC
FT                   EPHDELLGWALTPKGLWRLGG"
     atgggaccgc aatcctccgc gcaacgcaaa gccgcgcttc gggcgcagac caggtccgcg        60
     cggcgcgcgc tctcggacgc gcagcgggca gcgcgggacc gggcggtcga cgcccaggcc       120
     gcgcggatcg ccgagcggtt cggccccggc gacgtggtga gctcgtatgt gccgaccagt       180
     ctcgagccgg ggtccgaccg catgttggcg gcgttcgccg accggggggc gagcgtgctc       240
     gtccctgttg tcgtcggcgt ggacgcggcg ctcgcgtggc ggcattggcc ggaggaaggg       300
     caagacgcgc caccaggcgc gttggccgag gcggcagtcg ttcttgtgcc cgcgctcgcg       360
     gtcgaccggc ggggtgttcg cctcggtcaa ggcggggggc attacgaccg cagtttggcc       420
     gaggcaggtc caggggcgat gctcgtcgcg gtcgtggacg accgggagct ggtggacgag       480
     ctgccgtgcg agccgcacga cgagctgctg ggctgggcgc tcaccccgaa ggggctgtgg       540
     cgcctgggcg gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page