(data stored in ACNUC7421 zone)

EMBL: CP001958.PE501

CP001958.PE501       Location/Qualifiers
FT   CDS_pept        complement(488582..489472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96994"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96994.1"
FT                   /translation="MQFRVCAGGLCHYTERMFPRSRPRAAPVPARAATGLASRPQRGGA
FT                   DLLALAERASERADTLAKPLEQARLPSFPLLKITRALGVAVTITALASCGDPKEPGARR
FT                   AQSSQRVAPIAAEAIQSLFEPGHFNASGNIESMYSSASPPECRALVLEVDSPLLMRGQV
FT                   ASASAIAPKPGDKEHAQIVEIAAVYREGFSATDVIAEAAAMREHCEGTPITGSTQGGGN
FT                   STFQLIGQPSSGSPNILLWTLSALGKAWFCNNALIAAHNAAVEITSCYPSPAPKMRELA
FT                   QSALSRIERQARSSR"
     atgcaattcc gtgtgtgcgc gggcggtttg tgtcactaca ctgagcgcat gttcccacgc        60
     tcccggccgc gcgccgcgcc ggtgccagcc cgcgccgcca ccggcctcgc cagccgcccc       120
     cagcgcggcg gcgcggacct cctcgcgctc gccgaaaggg cttcagagcg cgccgacacg       180
     ctcgcgaagc cgctggagca agcccgtctg ccatcatttc ccctgctcaa gatcacgcga       240
     gcgctcggcg tggccgtgac gatcacagcc ctcgcctcgt gcggggaccc gaaagaaccc       300
     ggtgcccggc gggcgcaatc ctcgcaacgg gtcgcgccga tcgccgccga agcgatccaa       360
     agcctcttcg agcccggaca cttcaacgcc agcggcaaca tcgagagcat gtattccagc       420
     gcttcccctc ccgaatgccg cgccctggtg ctcgaagtgg actcgccgct gctcatgcgc       480
     ggccaagtgg cgagcgcctc cgcgatcgcg ccgaagcccg gggacaaaga gcacgcgcag       540
     atcgtcgaga tcgcggcggt gtaccgggaa ggcttctcgg cgaccgatgt gatcgccgaa       600
     gccgcggcga tgcgcgagca ctgcgaagga acgccgatca ccggctccac acaagggggc       660
     ggcaacagca ccttccagct gatcgggcag ccgagctctg gctcccccaa tatcctgctc       720
     tggactctct ccgcgctcgg aaaagcatgg ttctgcaaca acgccttgat cgccgcgcac       780
     aacgccgccg tggaaatcac gtcctgctac ccctcgcccg cgccgaaaat gcgggagctg       840
     gcccaatccg cgctgagccg catcgagcgc caagcccgat cctctcgctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page