(data stored in ACNUC7421 zone)

EMBL: CP001958.PE502

CP001958.PE502       Location/Qualifiers
FT   CDS_pept        489658..490287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0511"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: rha:RHA1_ro05695 50S ribosomal protein
FT                   L25/general stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96995"
FT                   /db_xref="GOA:D6ZC18"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC18"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADG96995.1"
FT                   /translation="MAETARVEATVRDEFGKGASRRARRDGHVPAVLYGHGIDPKHFNI
FT                   PAKEFARVLRANGVNAIVSLHAGGEEHLALTKTVVVHPTKSYLQHVDLQVIRRGERIAV
FT                   DVPVVLTGSAASGSVVQHETTTLSVEAEAMHIPEQIEVSIEGLEIGSKIIASELELPEA
FT                   VSLTGDPEQMIVQINEARAAQVEQDSAEGSDEAEADSSAEDGGEES"
     atggctgaaa ccgcccgcgt tgaagcgact gtccgcgacg agttcggcaa gggcgcgtcc        60
     cgccgcgccc gccgagacgg ccacgtgccc gccgtcctct acggccacgg catcgatccg       120
     aagcacttca acattcccgc gaaggaattc gcccgcgttc tgcgcgccaa cggcgtcaac       180
     gccatcgtga gcttgcacgc cgggggcgaa gagcacctcg ccctgaccaa gacggtcgtg       240
     gtgcacccga ccaagagcta cttgcagcac gtcgacctcc aggtcatccg ccgcggcgag       300
     cgcatcgccg tcgacgtgcc cgtcgtgctg accggctccg ccgcctccgg ctctgtggtc       360
     cagcacgaga ccaccaccct gtcggtcgag gccgaggcga tgcacatccc ggagcagatc       420
     gaggtctcca tcgaaggttt ggagatcggc tcgaagatca tcgccagcga gctggagctg       480
     cccgaggccg tgtcgctgac cggcgacccc gagcagatga tcgtgcagat caacgaggct       540
     cgcgccgccc aggtcgagca ggattcggcc gagggctcgg acgaagccga ggccgactcc       600
     tccgccgaag acggcggcga ggagagctga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page