(data stored in ACNUC7421 zone)

EMBL: CP001958.PE503

CP001958.PE503       Location/Qualifiers
FT   CDS_pept        490320..490880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0512"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   mab:MAB_1142c peptidyl-tRNA hydrolase (PTH); PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96996"
FT                   /db_xref="GOA:D6ZC19"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC19"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADG96996.1"
FT                   /translation="MIAGLGNPGPKYEKTRHNVGHMVVDLLLARAGGSLRAHKTSGMLA
FT                   ARLSFHGRGVILGKPTAYMNVCGPQIAKLAKYFSVPAADVVAVHDELDIGFGLVRLKRG
FT                   GGEAGHNGLRSLSSSLGTKEYCRVRVGVGRPPVGTQTADFVLAGFRADERKELPGLLER
FT                   SADAVEALVREGLEAAQNRVHSA"
     gtgatcgccg ggctgggcaa ccccggcccc aaatacgaga agacccgcca caacgtcggc        60
     cacatggtcg tggacctgct cctcgctcgg gcaggcgggt cgttgcgtgc gcacaaaacc       120
     tcaggcatgc tcgcggcacg gctgtccttc cacggccgcg gggtgatcct gggcaagccc       180
     acggcgtaca tgaacgtctg cggcccgcag atcgccaagc tcgcgaagta cttctccgtg       240
     cccgcggcgg atgtcgtcgc tgtgcatgac gaactcgata tcgggttcgg gctggtgcgg       300
     ctcaaacgcg gcggcgggga ggccgggcac aacggcctgc gctcgctgtc ctcttcgctc       360
     ggcaccaagg agtactgccg ggtccgggtc ggcgtcggcc gtccgccggt cgggacgcag       420
     acggcggatt tcgtcctcgc cggtttccgc gccgacgagc gcaaggagct ccccggcctg       480
     ctggagcgtt ccgccgacgc ggtggaggca ttggtgcgcg aggggcttga ggcggcgcag       540
     aatcgcgtcc attcggcata g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page