(data stored in ACNUC7421 zone)

EMBL: CP001958.PE511

CP001958.PE511       Location/Qualifiers
FT   CDS_pept        complement(497843..498727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0520"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: rer:RER_21240 thiosulfate sulfurtransferase;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97004"
FT                   /db_xref="GOA:D6ZC27"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC27"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG97004.1"
FT                   /translation="MHVDPASVAAGYAVPERVVSTEWLSANLGHRQLRLLEANEDSLVY
FT                   DAGHIPTAAKVDWRTELASPNSHDVLDPSRFASLLNSKGIDRNHTVVVYGDKQNRWAAH
FT                   LVWILTLFGHTDVRLLDGGRAAWLAEGRETTLDFPRLAQADYPLVKRDDETNRVFRDQL
FT                   ARSLGSCTVLDVRSPEEYAGPRRPVPEYPVERSARAGHIPSAKNIPWASAIHPSGHFLS
FT                   AAELTQVFDGLAEGKRSKVVTYCQIGERSAHTWFVLKFLLGVSSARNYDGGWSEWGNTV
FT                   AAPFATGEEPGAP"
     gtgcatgtgg accctgcttc tgtcgcagcc ggctacgcag tcccggagcg ggtcgtcagc        60
     accgaatggc tgtcggcgaa cctcggccac cggcaacttc gcctcctgga ggcgaacgaa       120
     gacagcctcg tgtacgacgc tgggcacatt ccgactgccg ccaaggtgga ttggcgcaca       180
     gagctcgcga gccccaacag ccacgacgtg ctcgaccctt cccggttcgc ctcgctcctc       240
     aacagcaaag gcatcgatcg caaccacacg gtggtggtct acggggacaa acagaaccgg       300
     tgggcggcgc acttggtgtg gattctgacc ctgttcgggc acacggacgt ccgcctgctc       360
     gacggcggac gcgccgcgtg gctcgccgag ggcagggaga cgacactcga cttcccgcgg       420
     ctcgcccaag cggattaccc gctcgtcaaa cgcgacgacg agacgaaccg ggtcttccgc       480
     gaccagctcg cgcgctcctt gggcagctgc accgttctcg acgtgcgcag cccggaggaa       540
     tacgccgggc cccgcaggcc ggtgccggaa tacccggtcg agcgttcggc gcgagccggg       600
     cacatcccct cggccaaaaa cattccctgg gccagcgcga tccacccaag cggacatttc       660
     ttgtccgccg cggagctcac gcaagtcttc gacggcctcg ccgagggcaa gcggagcaag       720
     gtggtgacgt actgccagat cggcgagcgc tccgcgcaca cctggttcgt gctgaaattc       780
     cttctcggcg tgtcgagcgc gcgcaattac gatggcgggt ggagcgaatg gggcaacacc       840
     gtcgccgcgc ccttcgccac aggcgaggaa ccgggcgccc catga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page