(data stored in ACNUC7421 zone)

EMBL: CP001958.PE514

CP001958.PE514       Location/Qualifiers
FT   CDS_pept        complement(499985..500167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97007"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97007.1"
FT                   /translation="MCSHAFEHAEESSGPPKHRIMRDTHHAFTVRRAAAPRPDIMEDLR
FT                   FQHAATESWGFVKIS"
     atgtgttcgc atgcgttcga gcatgccgaa gaatcctcgg gcccgcccaa gcaccgcatc        60
     atgagagaca cgcatcacgc tttcacggtc cggcgcgcag ccgctccacg ccccgatatc       120
     atggaagacc tgcgttttca gcacgccgcg acagagagtt ggggcttcgt gaaaatttca       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page