(data stored in ACNUC7421 zone)

EMBL: CP001958.PE516

CP001958.PE516       Location/Qualifiers
FT   CDS_pept        complement(500960..501484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0525"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   fra:Francci3_0826 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97009"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG97009.1"
FT                   /translation="MTMPPEPRTPDSWGPARSKTVQWHDPAPNAAAGRRMSGAEYLAAM
FT                   RDGRLPGPPISGLLGMELVSFGEGEVVFRCVPDDSAHNPIGVVHGGLVCALLDSVCGCA
FT                   AHTMLPAGVGYTSIELKVSYVRPVRSGDELTAKGWLVKPGSRVSFAEGEVRNQDGKVVE
FT                   TASSSLLIMKP"
     atgaccatgc ccccggagcc gcggaccccc gactcgtggg ggcccgcgcg ttcgaagacc        60
     gtgcagtggc acgaccccgc gccgaacgcg gcagccggtc ggcgcatgtc aggagccgag       120
     tatctcgccg ccatgcgaga cggcaggctg ccgggcccgc cgatcagcgg gctgctcggc       180
     atggagctcg tctccttcgg cgaaggcgaa gtcgtcttcc ggtgcgtgcc ggacgactcc       240
     gcgcacaacc cgatcggggt ggtgcacggc ggcctggtgt gcgcgctgtt ggactcggtg       300
     tgcggttgcg ccgcgcacac gatgctgccc gccggggtcg gctacacctc catcgagctc       360
     aaagtgagct acgtgcgccc agtgcgctcc ggcgacgaac tcaccgccaa gggctggctc       420
     gtcaaaccgg gctcgcgggt gagcttcgcc gagggcgagg tgcgcaacca agacggcaaa       480
     gtggtggaga ccgcgtcgag cagcctcttg atcatgaagc cctag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page