(data stored in ACNUC7421 zone)

EMBL: CP001958.PE517

CP001958.PE517       Location/Qualifiers
FT   CDS_pept        complement(501574..502152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_3968 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97010"
FT                   /db_xref="GOA:D6ZCG8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97010.1"
FT                   /translation="MAVTAFFDGTACGPAGAIRYDLRMIRLNLFFALLSLVLALAGPRG
FT                   YGLWGWWGLVAYLVGAVGSVGPWALGLIARIGVLERYDRLEPQFSKAAEALSVASVFIP
FT                   FLRAVNAMLAGVAFGAWLLNKRWLAQAAVLVATGLIALGGPLVQLAVGHRPIASANWAI
FT                   AAAPLAVMALWLLGRRFLRRQPAVRRPVR"
     gtggccgtca ccgctttctt cgacggcacg gcatgcgggc cagccggtgc gatccggtac        60
     gatctgcgaa tgatccggct gaacctgttc ttcgcgttgc tgtccttggt gctggcgttg       120
     gccgggccgc gcggttacgg gctgtggggt tggtggggcc ttgtggcgta cctcgtcggc       180
     gccgtgggaa gcgtgggccc ttgggcgctg gggttgatcg cccgcatcgg ggtccttgag       240
     cgctacgaca ggctggagcc gcaattcagc aaggccgccg aggcgctttc ggtcgcgagc       300
     gtcttcatcc cgttcctccg ggcggtcaac gccatgctcg ccggggtcgc tttcggcgcg       360
     tggctgctca acaaacgctg gctggcgcag gccgcggtgc tcgtggcaac cggtctcatc       420
     gccctcggcg ggccgcttgt ccagctcgcc gtcgggcatc gcccaatcgc ctccgcgaac       480
     tgggcgatcg cggctgcgcc gctcgccgtc atggccttgt ggctccttgg gcgccggttc       540
     cttcgccgcc agcccgccgt gcgcaggcct gtgcgataa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page