(data stored in ACNUC7421 zone)

EMBL: CP001958.PE518

CP001958.PE518       Location/Qualifiers
FT   CDS_pept        complement(502170..503123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0527"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="TIGRFAM: proline iminopeptidase; KEGG: gbr:Gbro_3091
FT                   proline iminopeptidase; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97011"
FT                   /db_xref="GOA:D6ZCG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG9"
FT                   /inference="protein motif:TFAM:TIGR01249"
FT                   /protein_id="ADG97011.1"
FT                   /translation="MRSLYPEIEPRATGHLDVGDGQRIFWEQVGNPEGKPAVFLHGGPG
FT                   GGINPKQRRFFDPKRYNVLLFDQRGCGRSTPHAGENPDLSLNTTWNLVSDIEKLREQMG
FT                   VERWLVFGGSWGSTLALAYAQTHPERVSELVLRGVFLCRESELDWFYNPGGASQIFPDL
FT                   WEEYLAPIPPAARGGNLIEEHAKLLWGRDQSAAEASAFAWTGWEDRTIGLTVDPHDREK
FT                   DPRTALAFARIENWYFQNKAFLRENQLLEDVDKIRHIPAAIVHGRYDVICPVASAWELH
FT                   RRWPESKLTITAQSGHTAFEAENTHHLVEATDAFAQ"
     atgcgcagcc tctaccctga aatcgaacct cgagccaccg gccacctcga cgtcggggac        60
     ggccagcgga tcttttggga gcaggtcggc aaccccgaag gcaaacccgc cgtcttcctg       120
     cacggcgggc cgggcggggg gatcaacccc aaacagcggc ggttcttcga cccgaaacgc       180
     tacaacgtgc tgttgttcga ccagcgcggc tgcgggcgtt ccaccccgca cgcgggcgag       240
     aatccagacc tgtcgctcaa caccacctgg aatctggtct cggacatcga gaagcttcgc       300
     gagcagatgg gagtcgaacg ctggctggtc ttcggcggct cctggggctc gacgctcgcc       360
     ctcgcctacg cgcaaaccca tcccgagcgg gtgagcgaac tcgtgctccg aggcgtcttc       420
     ctgtgccgcg aatccgaact ggactggttc tacaaccctg gaggcgccag ccaaatcttc       480
     cccgacctct gggaggagta cttggccccg atcccgcccg ccgcgcgggg cggcaacctc       540
     atcgaagagc acgcgaaact cctctggggc cgcgaccaaa gcgccgcgga ggcctccgcc       600
     ttcgcctgga ccggatggga agaccgcacc atcggcctga ccgtcgatcc gcatgaccgc       660
     gagaaagacc cgcgcaccgc gctcgccttc gcccgcatcg aaaactggta cttccaaaac       720
     aaggcgttct tgcgggaaaa ccaactgctc gaagacgtgg acaagatccg gcacatacca       780
     gcggcgatcg tccacggccg ctacgacgtg atctgccccg tcgcgagcgc ttgggagctg       840
     catcggcgtt ggccggagtc gaagttgacg atcaccgccc agtccgggca cacggcgttc       900
     gaagcggaaa acacgcacca cctggtcgaa gccacggacg cgttcgccca gtag             954
//

If you have problems or comments...

PBIL Back to PBIL home page