(data stored in ACNUC7421 zone)

EMBL: CP001958.PE519

CP001958.PE519       Location/Qualifiers
FT   CDS_pept        complement(503218..504045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0528"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: mva:Mvan_3602
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97012"
FT                   /db_xref="GOA:D6ZCH0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH0"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADG97012.1"
FT                   /translation="MSVSAAPYATQTRPRVRISHLHEMKREGRKWAMLTAYDYTTAALL
FT                   DAADIPVLLVGDSAANVVYGHDTTVSVEADELLPLVRGVARGAQRALVVADLPFGSYEA
FT                   SPAQAFETAARFARAGAHAVKLEGGEDYAEHISSLSRAGIPVMAHIGFTPQRVNSLSGF
FT                   RVQGRGDEAETLVHDAIAVAEAGAFAVVMEMVPAELAAQITAKLTIPTVGIGAGPDCDA
FT                   QVLVWQDMAGLTAGRTAKFVRRFAELGAALGEAAREYARDVESGAFPAPEHSY"
     atgtccgttt ctgctgctcc ttatgcgacg caaacccggc cccgcgtgcg gatcagccat        60
     ttgcacgaga tgaagcgcga aggccgcaag tgggcgatgc tcaccgcgta cgactacacc       120
     accgcggcgc ttttggacgc ggccgacatc cccgtgctgc tggtcggcga ctccgccgcc       180
     aacgtggtct acgggcacga caccacggtg tcggtcgaag ccgacgagct gttgccgctg       240
     gtgcgcggcg tcgccagagg ggcgcagcgc gccttggtcg tcgccgacct gcccttcggc       300
     agctacgagg cgagccccgc gcaagcattc gagaccgccg cccgcttcgc gcgggcaggg       360
     gcccacgcgg tgaaactgga gggcggcgag gactacgccg agcacatctc gtcgctcagc       420
     cgcgccggga ttccggtcat ggcccacatc ggattcaccc cccagcgcgt gaacagcctc       480
     tccggcttcc gggtgcaggg ccggggcgac gaagccgaga cgctggtcca cgacgccatc       540
     gcggtcgccg aggccggagc gttcgcggtg gtcatggaaa tggtgcccgc cgaactcgcc       600
     gcgcagatca ccgccaagct gaccattccg accgtcggca tcggagccgg gccggactgc       660
     gacgcgcagg tgctggtctg gcaggacatg gccggtttga ccgctgggcg cacggcgaag       720
     ttcgtccggc gcttcgccga gctgggcgcg gcgctgggcg aagccgcccg cgaatacgcc       780
     cgagacgtgg agtccggggc tttccccgcc ccggagcact cctactga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page