(data stored in ACNUC7421 zone)

EMBL: CP001958.PE524

CP001958.PE524       Location/Qualifiers
FT   CDS_pept        508644..509984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0533"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: rop:ROP_08930 glutamine synthetase I; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97017"
FT                   /db_xref="GOA:D6ZCH5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADG97017.1"
FT                   /translation="MNRQEEFVLRALEERDIRFVRLWFTDVLGYLKSVAIAPAELEGAF
FT                   AEGIGFDGSSIEGFSRVYEADMVAKPDPSTFQVLPWTTSSGKHHSARMFCDIAMPDGSS
FT                   SWADSRYVLRRQLNRALELGFSCYVHPEIEFFLLKDSPSKLAPPVPADDGGYFDQAVHD
FT                   SAPDFRRHVVHALEFMGISVEFSHHENAPGQQEIDLRYADALSMADNVMTLRYLVKEVA
FT                   IQEGVRATFMPKPFTQHAGSAMHTHMSLFEGEANAFHSPDDPLQLSPIGKSFIAGILEH
FT                   ANEISAVTNQWVNSYKRLVQGGEAPTAACWGASNRSALVRVPMYTPNKASSRRIEVRSP
FT                   DSSCNPYLTFAVLLAAGLRGVEKGYDLPAQAEDDVWSLSSAERKAMGYRPLPESLSEAL
FT                   TAMEGSELVAQALGEHVFDYFLRNKRHEWSEYSRQVTPFELHNYLAL"
     atgaaccgcc aagaggagtt cgtgctccgc gcgctcgaag aacgggacat ccgcttcgtc        60
     cgcctctggt tcaccgacgt gctgggttac ctcaagtcgg tggccatcgc cccagcggag       120
     ttggaaggag ccttcgccga gggcatcggc ttcgacggtt cctccatcga gggcttctcc       180
     cgcgtgtacg aggcggacat ggtcgccaaa ccggacccgt cgacgttcca ggtcctcccg       240
     tggaccacga gcagcggcaa gcaccactcc gcgcggatgt tctgcgacat cgcgatgccg       300
     gacggctcgt cctcctgggc cgactcccga tatgtgctgc gccgccagct caatcgcgcc       360
     ttggaactcg gtttctcttg ttacgtccac ccggagatcg agttcttcct gctcaaggac       420
     tcgccgtcga agctcgcccc gccggtgccc gccgacgacg gcgggtactt cgaccaggcc       480
     gtgcacgatt cggccccgga cttccgccgc catgtcgtcc acgcgctgga gttcatgggc       540
     atctcggtcg agttcagcca ccacgagaac gcgcccggcc agcaagagat cgacttgcgc       600
     tacgccgacg ccctgtccat ggcggacaat gtcatgacgt tgcgctacct ggtcaaagag       660
     gtggcgatcc aggagggcgt gcgcgccacg ttcatgccca aaccgttcac ccagcacgcc       720
     ggttccgcca tgcacacgca catgagcctc ttcgagggcg aggcgaacgc cttccacagc       780
     ccggacgacc cgctgcagct gtcgccgatc ggcaaatcgt tcatcgcggg catcctggag       840
     cacgcgaacg agatcagcgc cgtcacaaac caatgggtga actcgtacaa gcgactcgtc       900
     caaggcggcg aggcccccac ggcggcctgc tggggcgcgt caaaccgctc cgccctcgtg       960
     cgggtgccga tgtacacgcc gaacaaagcc tcctcgcgcc gcatcgaagt gcgcagcccg      1020
     gactcctcct gcaacccgta cttgacgttc gcggtcctgc tcgccgcagg tttgcgcggt      1080
     gtggagaaag gctacgacct gcctgcccag gccgaagacg acgtgtggtc cttgtcctcg      1140
     gcggagcgca aagcgatggg gtaccgcccg ttgccggaaa gcctgtccga ggccctcacc      1200
     gcgatggaag gctccgagct ggtcgcgcaa gccctcggcg agcacgtctt cgactacttc      1260
     ctgcgcaaca aacgccacga atggtccgag tacagccgtc aagtgactcc cttcgagctg      1320
     cacaattacc tcgctctgtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page