(data stored in ACNUC7421 zone)

EMBL: CP001958.PE525

CP001958.PE525       Location/Qualifiers
FT   CDS_pept        complement(510030..511040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0534"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase; KEGG: rop:ROP_63030
FT                   malate dehydrogenase; PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97018"
FT                   /db_xref="GOA:D6ZCH6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH6"
FT                   /inference="protein motif:TFAM:TIGR01759"
FT                   /protein_id="ADG97018.1"
FT                   /translation="MPHDLPGKDQPVVVAVTGAAGNIGYSAVFQIASGAMLGPGRRIVL
FT                   RLLETPAAARAAEGVAMELMDCAFGLLDSVEVHDDPAAAFAGANVALLVGAKPRARGME
FT                   RSDLLRANGGIFGPQGRALNEGAADDIRVIVVGNPANTNALIALSHAPDIPPERFTALT
FT                   RLDHNRALAQLAVKAGVRVGEVSRVSIWGNHSSTQYPDVFHARAGQLSGAQLAEDRSWL
FT                   ADEFIPTVAQRGAAIIEARGVSSAGSAATAAIDHIRDWALGREWGGDWTSVALPSPGVY
FT                   GVPEGLVSSFPARSVNGEWLIVEGLHVGEFSRARIDASVAELVSERDAVRALGLL"
     atgccgcacg atcttccggg aaaagaccag cccgtcgtcg tcgcggtcac cggcgctgcg        60
     gggaacatcg gctactcggc ggtgtttcag atcgcctccg gcgcgatgct cggcccgggc       120
     cggaggatcg tcctgcggct gctggagacg cctgcggcgg ctcgcgcggc agagggtgtg       180
     gccatggagc tgatggactg cgcgttcggg ctgttggact cggtcgaggt gcacgacgat       240
     ccggcagcgg cgttcgccgg ggccaatgtc gcgctgctcg tcggggcgaa accgagggcg       300
     cgcggcatgg agcggtcgga cctgctgcgg gcgaacggcg ggatcttcgg gccgcaaggc       360
     agggcgttga acgaaggggc agcggacgac atccgggtga tcgtcgtggg caaccccgcc       420
     aacacgaacg cgttgatcgc gctcagccac gcaccggaca ttccgccgga acgcttcacc       480
     gcgctcacca ggctcgacca taaccgcgct ctcgcccaat tggccgtgaa ggccggtgtg       540
     cgcgtgggcg aagtctctcg cgtgagcatt tggggcaacc attcgagcac gcagtatccc       600
     gacgttttcc acgcgcgggc cgggcagctg agcggcgcgc agctcgccga agaccgatcc       660
     tggctcgccg acgagttcat tccgaccgtc gcccagcgcg gcgcggcgat tatcgaggcg       720
     cgcggcgtct cctcggctgg ttcggcggcc acggcggcca tcgaccatat tcgcgactgg       780
     gcgctcggac gcgaatgggg cggggactgg acctcggtcg cgctcccctc gcctggggtc       840
     tacggcgtgc cggaaggttt ggtcagctcc ttccccgcgc gctccgtcaa cggggaatgg       900
     ctcatcgtgg aaggcctgca cgtgggcgag ttctcgcggg caaggatcga cgcctccgtc       960
     gcggagctgg tgtccgaacg ggacgcggtc cgggcgctcg gcctgttgta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page