(data stored in ACNUC7421 zone)

EMBL: CP001958.PE526

CP001958.PE526       Location/Qualifiers
FT   CDS_pept        complement(511084..512133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0706c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97019"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97019.1"
FT                   /translation="MRRIRPSANDAARRRPFRVAAMMLCAVVLTAGAGGCSADRSAEAR
FT                   AIGNAVRALPGVAAADVAYRSGASFRLDVTLAETASQTQAAAVGSTFVDRMRAGDFGGF
FT                   DVILNVAYPANSSRATKTSDSHASFQYHFRSAPENAASNPNPSSAEVASSLALWLQTAQ
FT                   SPATVGATVHQEALPGTNSRRSIVVSISSSVDDEAIAELIDAHPELRDATWKSSVPPGA
FT                   ARREFRVYRIHGQFPDRERRELWQQILERLGPDDDGDAVTDPAGAQASGALTNVKIDLW
FT                   AKPNTNERVEGITRAVVPLLPGLGSPVRVNIFSYTESVELILGGCSQPSPNHRPSALEA
FT                   ELRRQYERC"
     atgagacgca tccgcccgag cgcgaacgac gccgcacgac ggcggccctt tcgtgttgcg        60
     gcgatgatgc tctgcgcagt cgtcctgacc gccggggcgg gcggatgttc cgcagaccgc       120
     agcgccgagg cccgtgccat cggcaacgcc gttcgggcct tgcccggcgt ggcggccgcc       180
     gacgtcgcct atcgcagcgg cgcttctttc cggctggatg tgacactcgc ggaaacggcc       240
     tcgcagacgc aggccgcggc ggttggcagc acattcgtcg accgtatgcg cgccggggac       300
     ttcggcgggt tcgacgtcat cctcaacgtc gcctacccgg cgaacagcag ccgcgccaca       360
     aaaacctccg attcgcacgc gagcttccag taccacttcc gttccgcccc cgaaaacgct       420
     gcgagcaacc caaacccgtc cagcgcggaa gtcgcctcca gtttggccct gtggctccaa       480
     acggcgcagt cgcccgccac cgtcggggcc actgtgcacc aagaggcttt gcccgggacg       540
     aacagtcggc gcagcatcgt cgtctcgatt tcgtcatccg tcgacgacga ggcgatcgcc       600
     gagctcatcg acgcacatcc cgaactgcgc gacgcgacat ggaaatccag cgtcccgccc       660
     ggagcggccc gcagagagtt ccgcgtctac cgaatccacg gccaattccc cgaccgcgag       720
     cgccgcgagc tgtggcagca gatcctcgag cggctcgggc cggacgacga cggcgacgcg       780
     gtcaccgacc ctgcgggggc gcaggcctcc ggggcgctca cgaacgtgaa gatcgacctc       840
     tgggccaagc cgaacacgaa tgagcgggtc gaaggcatca cgcgggcggt cgtcccgctg       900
     ttgcccggtc tcggctcccc ggtgcgcgtc aacatcttct cgtacacgga gtccgttgag       960
     ctgatcctcg gcggttgcag ccagccttcg ccgaaccaca ggccctcggc gttggaggcc      1020
     gaactgcgcc gccaatacga acgctgctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page