(data stored in ACNUC7421 zone)

EMBL: CP001958.PE530

CP001958.PE530       Location/Qualifiers
FT   CDS_pept        complement(515477..515986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_03290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97023"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI1"
FT                   /inference="similar to AA sequence:KEGG:RER_03290"
FT                   /protein_id="ADG97023.1"
FT                   /translation="MSSQHAKGPVGLAVAVVREEGRWRVLGLSPKVLTSLEQAERELRE
FT                   LRSTSAVFGLINVDDEFFVIVRPGPGSSRLLLSDATAALDYDLAADVLDELHVEIPDPD
FT                   ELDDDEEPWAEGDFGILEDLGLPESVLGLIVSESDELYADEQLAALARQLGFEEELEKA
FT                   DQRPRG"
     atgtcgtcgc aacatgccaa ggggcccgtc ggactcgcgg tcgcggtcgt gcgcgaagag        60
     gggcgctggc gcgtgttggg cctgtccccc aaggtgctca cgagccttga gcaggccgaa       120
     cgagaactcc gcgagctgcg cagcaccagc gcggtgttcg gactgatcaa cgtggacgac       180
     gagttcttcg tgatcgtccg tccaggaccg ggaagctcgc ggctgcttct gtccgacgcg       240
     accgcggcgc tcgactacga cctcgccgcc gacgtccttg acgagctgca tgtggaaatc       300
     ccggacccag acgagctcga cgacgacgaa gagccttggg cggaagggga tttcggcatt       360
     ctcgaagact tgggcctgcc agagtccgtg ctcggcctca ttgtctccga gtccgacgag       420
     ctgtacgcgg acgaacaact cgcggcgctc gcccgccagc tcggctttga agaagagctc       480
     gaaaaggccg accagcgccc acgcgggtga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page