(data stored in ACNUC7421 zone)

EMBL: CP001958.PE533

CP001958.PE533       Location/Qualifiers
FT   CDS_pept        complement(518727..519632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0542"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="KEGG: mab:MAB_0968c luciferase-like hypothetical
FT                   protein; TIGRFAM: putative F420-dependent oxidoreductase;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97026"
FT                   /db_xref="GOA:D6ZCI4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI4"
FT                   /inference="protein motif:TFAM:TIGR03560"
FT                   /protein_id="ADG97026.1"
FT                   /translation="MRFSLWASASQSWPDLLDVARLADSGGWHALYLADHFMPRAATAA
FT                   DPGGPMLEATAALSALAAATHRVRLAHLVLSMTYRHPAVLANWAATTDQIANGRLTLGI
FT                   GAGWQENEHRAYGLALGTPKERVDRFAEGLRAIRGLLGQTATTLSGEYYQLDGAVSEPK
FT                   PVQEHMPVLIGASGPRMLSLVAQHGDEWNTWTKPGEFRTAAEPLDAACERHGRDPKSVR
FT                   RSTQAGILVTDEPERARAFEADTRMPSAIAGTAQQIAEKAALWKDEGVDEIIIRDESLG
FT                   RGQRRADACAALWEALSQLR"
     atgcgtttct cgctctgggc ctccgcctcg caatcctggc cagaccttct ggacgtggcc        60
     cgcctcgccg actccggcgg ctggcacgcc ctctacctcg ccgaccactt catgccccgc       120
     gctgcgaccg ccgcagaccc aggcggcccc atgctggagg ccaccgccgc gctgtcggcg       180
     ctcgcagcgg ccacacacag ggtccgcctt gcgcacctcg tgctgtcgat gacctaccgg       240
     catcccgccg tgctcgcgaa ctgggccgcc acgaccgacc agattgccaa cgggcggctc       300
     acgctcggga tcggcgcggg ctggcaagag aacgagcacc gcgcctacgg gctggcgctg       360
     ggaacgccga aggagcgcgt cgaccgcttc gccgaaggcc tccgggcgat ccggggcctg       420
     ctcgggcaga cggccaccac cctctcgggc gagtactacc agctggacgg ggccgtgagc       480
     gagccgaagc cagtccagga gcatatgccc gtcctgatcg gggcctcggg cccgcgcatg       540
     ctctcactcg tcgcccagca cggcgacgag tggaacacat ggaccaaacc cggcgagttc       600
     cgcacagcgg ccgaaccgct cgacgcggcg tgcgaacgac acgggcgcga cccgaaatcc       660
     gtgcgccgct ccacccaggc cggaatcttg gtcaccgacg agccggagcg ggcgcgggcg       720
     ttcgaagcag acaccaggat gccctcggcc atcgccggaa ctgctcagca gatcgcggag       780
     aaggccgccc tgtggaagga cgagggcgtg gacgagatca tcatccgaga cgagtccctc       840
     gggcgcggcc aacgccgcgc cgacgcgtgc gcggccttgt gggaggcgct gagccagctg       900
     cgctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page