(data stored in ACNUC7421 zone)

EMBL: CP001958.PE534

CP001958.PE534       Location/Qualifiers
FT   CDS_pept        complement(519676..521220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0543"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: stp:Strop_1545 TAP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97027"
FT                   /db_xref="GOA:D6ZCI5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG97027.1"
FT                   /translation="MKPMRRFLPSLLAALLIAGCAHTDESGPSGKSAPSSPARPALAWE
FT                   PCPWEGDFLRAIGTERAAQFQHGFELGCASVTVPQDHDKADGQTMRVALSRTRSKDAGG
FT                   KNRPPLLVNFGGPGQPGVREAAAMALRAENDLAAHFDVIGFDPRGVGESEPVVCGPDPA
FT                   QEAKQQVLDPRDPAQLAKLRARVAAVAQDCEAKYGSKLAAINTYQTAQDIDSIRVALGA
FT                   QRIDYLGYSYGTFLGAAYAHLHPRQIRAAVFDSPVDLRRDPVKTEEEAVQAKEKAFDSF
FT                   FDWTKTQPSYADLASARGFLGQGLLDPGAGQLLAGISTLLSSPAKWPDLAEGLRSVMST
FT                   GDSAALRKADPGFSMANWTVLCDDLPQDRRPDDAAVRSLASQWAQKYPTFGLYELGYGN
FT                   GLVTGCAGWPAPAHPVTSDFIDRAAPPAGGAPGPKPLVVSGETDPTTPLAWAAPFTEAV
FT                   GGVLLVTAEPGHGHYLRGGARRAPENGAAEKNCVDAAVDDYLVTGTLPPESSRCPV"
     atgaagccta tgcgacgttt cctcccgtct ctgctcgccg cgctcctgat cgcaggctgc        60
     gcgcacaccg acgagtccgg gccgagcggc aagagcgccc ccagctcgcc cgcgcgaccc       120
     gcgctggcct gggagccttg cccctgggag ggcgacttcc tgcgcgccat cggcacagag       180
     cgcgcggccc agttccagca cggcttcgag ctcggatgcg cgagcgtcac cgtcccgcaa       240
     gaccacgaca aggccgacgg ccagaccatg cgcgtcgcgc tctcccgcac ccggtccaag       300
     gacgcgggag gcaagaaccg ccccccgctc ctggtgaact tcggcgggcc gggccaaccc       360
     ggcgtccgcg aggccgccgc catggccctg cgcgccgaga acgacctcgc cgcgcatttc       420
     gacgtcatcg gcttcgaccc gcgcggcgtc ggcgagtctg agcccgtcgt gtgcggccca       480
     gatcccgcgc aagaggccaa acagcaagtc ctggacccgc gcgacccggc gcaactggcc       540
     aaactcaggg ccagagtcgc cgcggtggcg caggactgcg aggccaaata cggctcgaag       600
     ctcgccgcga tcaacacata ccagaccgcg caggacatcg acagcatccg cgtcgccctc       660
     ggcgcgcagc gcatcgacta cctcggttac tcctacggga cgttcctcgg ggccgcctac       720
     gcccacctgc atcctcggca gatacgcgca gcggtcttcg actcccccgt cgacctgcgg       780
     cgggacccgg tgaaaacgga agaggaagcg gtccaggcca aagagaaagc cttcgactcg       840
     ttcttcgact ggacgaagac ccagccgagc tacgcggacc tcgccagcgc tcggggcttc       900
     ctggggcaag gcctcctcga ccctggggcc gggcagctgc tcgccgggat cagcaccctg       960
     ctgtcctccc cggcgaagtg gccagacctc gcggaaggcc tgcgctcggt gatgagcaca      1020
     ggcgacagcg cggcgctgcg caaggctgat ccgggcttct ccatggcgaa ctggactgtg      1080
     ctctgtgacg atctgccgca agaccgccgc ccggacgacg cggcggtgcg gagcctcgcg      1140
     tcgcaatggg cgcaaaaata tccgaccttc gggctgtacg agctcggcta cggcaacggt      1200
     ctggtgaccg gatgcgccgg ttggcccgcg cccgcccacc cggtcacatc cgacttcatc      1260
     gacagggccg ccccgccggc gggtggggcc ccaggcccca agccgctggt cgtcagcggc      1320
     gagacagacc ccaccacccc cctggcctgg gccgcgcctt tcacggaagc tgtcggcggc      1380
     gtcctgctcg tgaccgccga accaggccac ggccattact tgcgcggggg cgcgcggcgc      1440
     gcgcccgaaa acggcgcggc ggaaaagaac tgcgtggacg cagcagtgga cgactacctc      1500
     gtcaccggga cactgccccc ggagagctcg cgctgccccg tctga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page