(data stored in ACNUC7421 zone)

EMBL: CP001958.PE536

CP001958.PE536       Location/Qualifiers
FT   CDS_pept        521771..522241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0545"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: gbr:Gbro_3805 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97029"
FT                   /db_xref="GOA:D6ZCI7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI7"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADG97029.1"
FT                   /translation="MSRKGPAPRRAVVNDPVYGSPVVTQLVNKILLDGKKSVAERIVYS
FT                   ALERARDKTGTDPVVTLKRALENVKPTMEVRSRRVGGATYQVPGPVAPGRSNTLALRWL
FT                   VKFSRARREKTMEERLANELLDASNGLGASVKRREDTHKMAEANRAFAHYRW"
     atgtcccgca agggccccgc gccgcgccgc gccgtggtga acgatccggt gtacggctcg        60
     cccgtcgtca cccagctggt caacaagatc ctcctcgacg gcaagaagtc cgtcgccgag       120
     cgcatcgtct acagcgccct tgagcgcgct cgcgacaaga ccggcaccga ccccgtcgtc       180
     accctcaagc gcgcgctgga gaacgtgaag ccgaccatgg aggtccgctc ccgccgcgtc       240
     ggcggcgcga cctaccaggt gcccggcccg gtcgcgccgg ggcgttccaa cacgctcgcg       300
     ctgcgctggc tggtcaaatt ctcccgcgcc cgtcgggaga agaccatgga ggagcgtctc       360
     gccaacgagc tgctggacgc ctcgaacggc ttgggcgctt cggtgaagcg tcgcgaagac       420
     acccacaaga tggctgaggc caaccgggct ttcgcgcatt accggtggtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page