(data stored in ACNUC7421 zone)

EMBL: CP001958.PE541

CP001958.PE541       Location/Qualifiers
FT   CDS_pept        complement(529307..530575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_2797 sialic acid-transport integral membrane
FT                   protein NanT"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97034"
FT                   /db_xref="GOA:D6ZCJ2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97034.1"
FT                   /translation="MRKPSPWADLDRDQRSAFLASWLGWAMDAFDFFILTLVLNEIGQE
FT                   FHVSKRQLTFLITVTLVMRPLGAYLFGIWADKAGRRVPLMVNVCFYSTVGFLGAFAPNF
FT                   AVLVVLRLLYGIGMGGEWGIGAALTMEKVPPGKRGFFSGILQAGYASGFLFASVAHLFL
FT                   HSCLGLSWRWLFGLSILPALISLIVRAFVKESEVWVSTQEKMRAHGSSVRAVFFDPAVL
FT                   RRFGYLILLMTAFTSLSHGTQDLYPTFLKETEHAGRALSSAVADWVMIVANAGAIIGGV
FT                   FFGSLSDRIGRRGVIVLGSLTTLPLLPLFTVPHNPWLLGLGMFLVQATTQGAWAAVPAH
FT                   LSELSPNAIRGFYPGVTYQLGNLCTSCNATLQTGMAAAWGYPVSFWVLVGAACVSLAAL
FT                   TWFGPHADGVDFTAQDEKETAFD"
     atgcgcaagc cttccccttg ggccgatctt gaccgcgacc aacgcagcgc cttcctcgcc        60
     tcgtggctcg gttgggcgat ggacgccttc gattttttca tcctcacgct ggtgttgaac       120
     gagatcgggc aggagttcca tgtctccaag cgccaactca cctttctcat caccgtcacc       180
     ttggtgatgc gcccgctcgg ggcgtacctg ttcgggatct gggcggacaa agcgggcagg       240
     cgcgtcccgt tgatggtgaa cgtgtgcttt tattcgacgg tggggttcct cggcgccttc       300
     gcgccgaact tcgccgtcct tgtggtcctg cgtctgctct acgggatcgg catgggcggg       360
     gaatggggca tcggggccgc gctgaccatg gagaaggtgc cgcccggcaa acgcggcttc       420
     ttctctggga tcttgcaggc cggttacgcc agcggcttcc tcttcgcctc cgtcgcgcat       480
     ttgttcttgc actcctgcct ggggctttcc tggcgctggc tgttcggcct gtccatcctg       540
     cccgcgctca tctccctcat cgtgcgcgcc ttcgtcaaag agtccgaggt ctgggtgtcc       600
     acacaggaga agatgcgggc gcacggctcg tcggtgcgcg cggtgttctt cgacccggcc       660
     gtcctgcgcc gcttcggcta cctgatcctg ctcatgaccg cgttcacgtc gctctcccac       720
     ggcacccaag acctgtaccc gacctttttg aaggagaccg agcacgcggg ccgcgcgctg       780
     tcctcggccg tcgccgactg ggtcatgatc gtcgcgaatg ctggggcgat catcggcggc       840
     gtttttttcg gatcgctctc cgaccggatc gggcgacgcg gcgtcatcgt cctcggctcg       900
     ctgacgaccc tgccgctcct gccgctgttc actgtgccgc acaacccatg gctgctcggt       960
     ttggggatgt tcctcgtcca agcgacgacc caaggggctt gggccgcggt gcccgcgcat      1020
     ctctccgagc tgtcccccaa cgccatccgg ggcttctacc ccggcgtgac ctaccagctc      1080
     ggcaatctct gcacctcgtg caacgcgacc ctgcaaaccg gcatggctgc ggcatggggt      1140
     tatccggtct cgttctgggt ccttgtcggc gcggcgtgcg tttcgctcgc ggccctcact      1200
     tggttcggcc cgcacgccga cggggtggac ttcaccgccc aggacgagaa agaaaccgct      1260
     tttgattag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page