(data stored in ACNUC7421 zone)

EMBL: CP001958.PE542

CP001958.PE542       Location/Qualifiers
FT   CDS_pept        complement(530647..531831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0592 proteinase inhibitor I4, serpin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97035"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97035.1"
FT                   /translation="MRRAVAFAAAAVLAGCASGAAKEEPHLEALSSRVKFAEIGVDAHQ
FT                   EAVTALARRSAQLALDELDALAPDHDTVFSPWALVRRERIIADANGAGEDPAIAAMIGQ
FT                   LEKWQGDPDSVPNAGADGTPVLRSRTALIADRSLAVAPEFLDLLAENFDMGLYLARGGD
FT                   PKLAEAVNGWALGTVNARFSGPMPGLGAQHGVYFADLTELLAGWRFPFRPEWTSPAPFT
FT                   TAGGASAQPPTMRGVVLARTAAGTGWRAAELPLADGVEMRLVIPVDPRASLSGILPAAR
FT                   TALASAPPAPLGFALPRWSALADLTGAAEATAQAALPRLAPEARASGWSSQAAVAFGEQ
FT                   GVSMAPPPPVSGPGGATAPAPAISFAADHAFCFEIFDPGTGLVLLAGRAAHPGS"
     atgaggagag ctgtcgcttt cgcagcagcc gccgtgctcg cagggtgcgc gagcggagcc        60
     gccaaggagg aaccgcatct tgaggcgctt tcctcgcgag tgaagttcgc ggaaatcggc       120
     gtcgacgcgc accaggaagc cgtcacagcg ctcgcccggc gcagcgccca gctcgccctt       180
     gacgaactcg acgcgctcgc gccggaccat gacacggtgt tcagcccatg ggccctcgtt       240
     cgccgcgaac ggatcatcgc tgacgcgaac ggcgcaggcg aggaccctgc gatcgccgcg       300
     atgatcggcc aactcgaaaa gtggcagggc gaccctgaca gcgtcccgaa cgccggggcc       360
     gacggcacac ctgttctgcg cagcaggacc gcgctgatcg cggaccggtc cctcgcagtc       420
     gcccccgaat tcctcgacct gctcgccgaa aacttcgaca tgggcctcta tctcgcgcga       480
     gggggcgacc cgaaactggc cgaggcggtg aacgggtggg ctctgggcac ggtcaacgcg       540
     cgcttcagcg gacccatgcc ggggctcggc gcgcagcacg gggtgtattt cgccgatctg       600
     accgaactgc tggcggggtg gcgtttcccg ttccggcctg aatggacctc gccagcgccg       660
     ttcaccacgg cgggcggcgc gtcggcgcag ccgcccacca tgcgcggcgt cgtcctcgcc       720
     cgcacggcag cggggactgg ttggcgggcc gcagagctcc cgctcgccga cggcgtcgag       780
     atgcggctgg tcatccccgt cgacccgcgc gcctccctct cgggcatatt gcccgcggcc       840
     cgcaccgcct tggcgagcgc cccgcccgca ccgctgggct ttgccctgcc gcgctggtcc       900
     gcgcttgccg acctgaccgg agccgcagaa gcaaccgccc aggccgccct tccccgcctc       960
     gcgcccgaag ccagggcgag cggctggtcg agccaggccg ctgtggcgtt cggcgagcaa      1020
     ggcgtgtcga tggcgccgcc gccccccgtc tcagggcctg gcggcgcgac ggccccggcg      1080
     cccgcgattt ctttcgccgc ggaccacgcc ttctgcttcg aaatcttcga tccggggacc      1140
     ggcttggtgc tcctcgccgg acgcgccgcg caccccggct cctaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page