(data stored in ACNUC7421 zone)

EMBL: CP001958.PE543

CP001958.PE543       Location/Qualifiers
FT   CDS_pept        complement(531855..532967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0554"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mjl:Mjls_2593 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97036"
FT                   /db_xref="GOA:D6ZCJ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG97036.1"
FT                   /translation="MTQLSETVLEEPVAKTMQAVVCHGPQDYRVEEMPVPVPGPGEALI
FT                   RVEAVGICGSDLKCFQGAAKFWGDEGRAPWAHTGVIPGHEFVGRVVRIDEDASLRWGVK
FT                   LGDRVSAEQIVPCWECRFCRKGNYHMCVPHDIYGFRRGYNGAMATYMLFPAKSLVHKIS
FT                   GELAPEHAAFCEPLACSLHAVQRAHIRFDDVVVVAGCGPIGLGMIAGAKARNPQHIVAL
FT                   DMKPEKLELAARCGADTTVDISQNDPNGVVLELTEGLGADVYLEGTGHASAVPQGLKLL
FT                   RKQGKYIEYGVFRDAVAVDWTIISDDKELDVLGAHLGPNCWPTAIRMLESQSLPLDDIC
FT                   THQFPLTDFEKGFELVGDGSRSVKVSLIPS"
     gtgacgcaac tgtctgagac cgtgctggaa gagcccgtcg cgaagaccat gcaggcagtg        60
     gtctgccatg gcccccagga ttaccgcgtc gaggaaatgc ccgtgcccgt gcccggcccc       120
     ggagaagcct tgatccgggt cgaagcggtg gggatctgcg gaagcgacct caaatgcttc       180
     caaggagccg cgaagttctg gggcgacgag ggccgggccc cgtgggcgca caccggcgtg       240
     atccccggcc acgagttcgt gggccgggtc gtgcgcatcg acgaggacgc gtccctgcgc       300
     tggggggtga aactcggcga ccgggtgtcc gccgagcaga tcgttccctg ttgggagtgc       360
     cgtttctgcc gcaaggggaa ctaccacatg tgcgtgccgc acgacattta cggattccgc       420
     cgaggctaca acggcgccat ggccacctac atgctcttcc cggcaaaatc gctggtgcac       480
     aagatctcag gagagctggc gcccgagcac gcggcgttct gcgaaccgct cgcctgctcg       540
     ctgcacgcag tgcaacgagc ccatatccgg ttcgacgacg tggtggtcgt ggcgggctgc       600
     gggcctatcg gcctcggcat gatcgccggg gcgaaagccc gcaacccgca gcacatcgtg       660
     gcgttggaca tgaaaccgga aaaactggaa ctggccgccc gttgcggcgc ggacaccacg       720
     gtggacatct cgcagaacga tccgaacggg gtcgtcctcg aactcaccga ggggctcggc       780
     gcggacgtgt acctggaagg caccggccac gcctctgctg tgccgcaagg cctcaaactc       840
     ctgcgcaaac aaggaaaata catcgagtac ggggttttcc gggacgcggt cgccgtcgac       900
     tggaccatca tcagcgatga caaagagctc gatgtcctcg gcgcgcattt gggcccgaac       960
     tgttggccga cagccatccg catgctcgag tcccaaagcc tcccgctcga cgacatttgc      1020
     acccaccaat tcccgctgac ggatttcgaa aagggcttcg aactcgtcgg ggacggatcg      1080
     cggtccgtga aggtctcgct catcccttcc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page